KEGG   Bacillus cereus Q1: BCQ_4403Help
Entry
BCQ_4403          CDS       T00852                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00030  Pentose phosphate pathway
bcq00051  Fructose and mannose metabolism
bcq00052  Galactose metabolism
bcq00680  Methane metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
bcq01230  Biosynthesis of amino acids
bcq03018  RNA degradation
Module
bcq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_4403 (pfk)
   00030 Pentose phosphate pathway
    BCQ_4403 (pfk)
   00051 Fructose and mannose metabolism
    BCQ_4403 (pfk)
   00052 Galactose metabolism
    BCQ_4403 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BCQ_4403 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BCQ_4403 (pfk)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCQ_4403 (pfk)
Protein phosphatases and associated proteins [BR:bcq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCQ_4403 (pfk)
Messenger RNA biogenesis [BR:bcq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BCQ_4403 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACM14829
UniProt: B9J099
Position
complement(4318996..4319955)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMEDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaactaggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccatgtgtt
ggtgtaccaggtacaattgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcggaaacaatcttaattccagaagaagagtatgacatggaagat
gttatcgctcgtctgaagcgcggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgcgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagccgtcttggtgcaagagcagttgaattattaattgctggtaaaggt
ggacgttgtgtcggtattcaagataacaaacttgttgatcatgatattatcgaagcgtta
gctcaaaagcatacaatcgataaagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system