KEGG   Bacillus cereus Q1: BCQ_4461Help
Entry
BCQ_4461          CDS       T00852                                 

Gene name
acsA
Definition
acetate--CoA ligase (acetyl-co a synthetase)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bcq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcq00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bcq00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bcq00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4369695..4371281)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQPVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGIP
VQVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaatcgccga
gaagttacatacgcggagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaagggggacaagctcctcattatgatgccgcgtttaattgaagcatac
atgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaaatgtta
cgcaaaaaggatatcgagtaccgcattggacatggggaagtaaaagcaatcgtaagttat
gagccgtacattggacagtttgatgatatagaagcgatggaatcccttcaaaaattcgtt
ctgagcgagcagccagtagatggatggatcaatttaaaaacagcgttagaaacagaaagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacgggaaatccaaaaggtgttgttcatacacatgcgtgggcatacgctcattta
cgtacgagcgctccaaattggctcggaattgaagagaatgatgttgtgtgggcaacagct
agtccaggctggcagaagtggatttggagcccgtttttagcaactctaggctcgggggca
acaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccgactgagtatagattaatggcaaaagtagaa
aatttaagtgaatacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaagcactttcatattacagtaagagacggctat
gggcaaacggaaaacacattgcttgttggtgtaatgaaaggaatggatattagaccagga
tcaatggggaaaccgacgccgggtaaccacgttgatattgtaaatgaggaaggtattccg
gtacaggtaggcgaagttggtgatattgcagttcacattgaaacgccggcactctttaaa
caatattacaaagacgatgagcgtacagcgatgcaattccgcggtgattattatattaca
ggtgataaagcgaaaaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttacgtgagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaagaacttactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgagcttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system