KEGG   Bacillus cereus Q1: BCQ_4478Help
Entry
BCQ_4478          CDS       T00852                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase (acetyl-CoA synthetase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00620  Pyruvate metabolism
bcq00640  Propanoate metabolism
bcq00680  Methane metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_4478 (acsA)
   00620 Pyruvate metabolism
    BCQ_4478 (acsA)
   00640 Propanoate metabolism
    BCQ_4478 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BCQ_4478 (acsA)
Enzymes [BR:bcq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCQ_4478 (acsA)
Lipid biosynthesis proteins [BR:bcq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCQ_4478 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: ACM14904
UniProt: B9J166
Position
complement(4385494..4387212)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPAMMRGIW
NNKQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtgaatatggcgtatgaggcaattgataagcatgcgaaatccgatcggaagaataaa
gtagccctttattatcaagatggatctcgaaaagagaagtatacatttaaggaaatgaag
gatttttctaataaagcaggaaatgtcctaaaaaattatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccgcgttccccagagttatatttcgcacttcttggtgcagtg
aagttgggagcaattgttggtccgctatttgaagcatttatggaaggcgcagttcgcgat
cgtttagaagatagcgaagcaaaagtgttaattacaacacctgaattgttagagcgtgta
ccattaaatgatttaccagctttaaaaacagtctttcttgttggagataatgtagaagaa
ggcggtaaaacggtagcgttcaatcctttattcgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattctacattacacgtctggttctactggtaag
ccaaaaggtgtgcttcatgcacaaaacgcaatggttcagcactatcaaacggcgaagtgg
gtattagatttaaaagaagacgatgtatattggtgcacagctgacccaggctgggtaacg
ggaactgcttacggtatttttgcaccgtggttagtcggagcatcaaatgttattttaggc
ggacgctttagtccagaagcgtggtatgaagcactgcaagattacggtgtaacagtttgg
tatagtgcaccaacagcatttcgcatgttaatgggcgctggacaagatgcaattaaaaaa
tacgatttatcacaagtgcgccacgtattaagcgttggtgaaccgttaaatccagaagta
attcgctggggtatgaacgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactacccttgtatggaaatacgtccaggttcaatgggg
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgcctcca
tacacaatgggtaacttagcaattggcaaaggttggccagctatgatgcgtggaatttgg
aataacaagcaaaagtatgaatcttactttatgccgggcgattggtacgtatcaggtgat
tctgcctatatggacgaggatggatacttctggttccaaggacgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggaccatttgaagtagaaagcaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccggtgcgcggcgaaatcattaaa
gcatttatcgcgcttcgtgcaggatacgaaccatctgatgaattaaaagaagaaatccgt
caatttgtaaagaaaggcctagcagctcatgcagcgccaagacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagtta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system