KEGG   Bacillus cereus Q1: BCQ_4517Help
Entry
BCQ_4517          CDS       T00852                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00300  Lysine biosynthesis
bcq01100  Metabolic pathways
bcq01120  Microbial metabolism in diverse environments
bcq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCQ_4517
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BCQ_4517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACM14943
UniProt: B9J1A5
Position
complement(4422422..4423828)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDNLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFESGRRLNMVPDFAEAVVTGEDVSALTVAY
EEYLQTAKKIGEAIVEGNTVTLQIKGVSAHGSTPEKGENAGLLLANFLTKVALDGKGESF
VSFATETFTGDTLGEKAGISYKDDISGPLTVNVGRLSYTKENGGSLGLNVRYPVTTNFEE
MIAKLKEYVGNHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIYELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcaaaacgaaaagataatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagagggcgca
ccattcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaacggaa
ggctttacttctaaaaatttagaagggtatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cctgcatatagtgcagatattcgtgatgggaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcttactatgcgatgaaaattgtgaaagaattaggtttacct
ctttcaaaacgtgttcgtatgattttaggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaatgaagaaatgccaacaatcggttttgcgccagacgcggacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaagaaaggtacatatgaacttgtttcatttgagtcaggtcgccgtttaaatatggtt
cctgattttgcagaagcggttgttacaggagaggatgtaagtgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggtgaagcaattgtagaaggtaatacagta
acgttgcaaattaaaggggtttcagctcacggatctactcctgaaaaaggagaaaatgca
ggtttattactggcaaacttcttaacgaaagttgctcttgatggaaaaggggaatcgttt
gtatcgtttgcaacagaaacatttacaggagatactttaggagagaaagctggtatttct
tataaagacgatattagtggtccattaacagtgaatgttggtcgtctttcttatacgaaa
gaaaatggtggcagtttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtgggtaatcatggatttgaagtagctgattattca
aactctcgtccgcatcacgttgataaagaccacgtattaattcgtacgttgcagcgcgta
tatgaagaacaaacaggtgaaaaagcagaactattagcaattggcggtggtacttacgct
cgttcgttaaaagctggtgttgcatttggcccattgttccctggaaaagaagaacttgcg
catcaaaaagatgagtatattgaaattgaagacttattaaaagcaacagcaatttacgcg
caagcaatttatgaattagcgaagtaa

DBGET integrated database retrieval system