KEGG   Bacillus cereus Q1: BCQ_4788Help
Entry
BCQ_4788          CDS       T00852                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcq  Bacillus cereus Q1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCQ_4788 (gpmA)
   01230 Biosynthesis of amino acids
    BCQ_4788 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_4788 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCQ_4788 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_4788 (gpmA)
Enzymes [BR:bcq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCQ_4788 (gpmA)
Exosome [BR:bcq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCQ_4788 (gpmA)
  Exosomal proteins of melanoma cells
   BCQ_4788 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4658450..4659004
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLENQLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLAERILSDVSMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
EDVLKLNHTTILLVTHGNLLTLILKHFDHTIGFHEWRALTNPDMYEITIDEQCSLKRLWK
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcattgtaatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattccttttagaaaaccaa
ctacaaatagatcatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcactccaagctaatttgtctatccaagaagatgaacgcttagctgaacgcatatta
agcgacgtttcaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacggaccgtgctatatcgcttatc
gaagacgttttaaaattaaaccatactacaatattactcgttacacatggaaacttactt
acgctcattttaaagcactttgatcatacgatcggctttcatgaatggagagctttaacg
aatcctgatatgtacgaaattacaattgatgaacaatgtagcctaaaacgattatggaaa
gcaccgtccaagtaa

DBGET integrated database retrieval system