KEGG   Bacillus cereus Q1: BCQ_4935Help
Entry
BCQ_4935          CDS       T00852                                 

Gene name
estA
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bcq  Bacillus cereus Q1
Brite
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BCQ_4935 (estA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4802529..4803269)
Genome map
AA seq 246 aa AA seqDB search
MKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEEL
VHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMYI
KSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDMI
YAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYNF
LEQLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgttttatta
ctacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaaaag
aaaggctacacttgtcatgcgccaatttataaagggcacggagtaccgccagaagagctt
gttcatacaggtcctgaagattggtggcaagatgtaacggaggcatatcagcttttaaaa
gataaagggtttgagaaaattgctgtcgttggattgtcacttggcggcgtattttcacta
aaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccaatgtatatt
aagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaagcgt
gagcaaaaatcaccagagcaaatagaacaagaaatgttggaattccaaaagacaccgatg
aatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatgatt
tatgcaccaacatttgttgtacaagcgcgtcatgatgaaatgattaatacagatagtgcg
aacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagactct
acgcatgtcattacacttgataagcagcgtgacgagctacatgaggatgtatataacttc
ttggagcaactagattggtaa

DBGET integrated database retrieval system