KEGG   Bacillus cereus Q1: BCQ_5112Help
Entry
BCQ_5112          CDS       T00852                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00040  Pentose and glucuronate interconversions
bcq00052  Galactose metabolism
bcq00500  Starch and sucrose metabolism
bcq00520  Amino sugar and nucleotide sugar metabolism
bcq01100  Metabolic pathways
bcq01130  Biosynthesis of antibiotics
Module
bcq_M00362  Nucleotide sugar biosynthesis, prokaryotes
bcq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCQ_5112 (gtaB)
   00052 Galactose metabolism
    BCQ_5112 (gtaB)
   00500 Starch and sucrose metabolism
    BCQ_5112 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCQ_5112 (gtaB)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCQ_5112 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD Smr
Motif
Other DBs
NCBI-ProteinID: ACM15512
UniProt: B9IRQ4
Position
complement(4984400..4985272)
Genome map
AA seq 290 aa AA seqDB search
MNKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNNR
RYQVRQFVEKPAEGTAPSNLAIMGRYVLTPEIFVFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKLGFIKTTVELALKNRELRQNLLEFIKKKLNNDR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaagtaagaaaagcaattattccagctgctggtcttgggacgagatttttacca
gcaacgaaagcaatgccgaaagaaatgttacctatcgtcgataaaccaacaattcaatac
ataatagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaagga
aaacgcgcgattgaagatcattttgatcattcatttgaactagaacaaaaccttttagaa
aaaggtaagtatgaaatgcttgagaaagtacaagcttcttcaagaattaacattcattac
ataagacaaaaggaaccgaaaggcctgggacacgcagtatggtgtgcacgtaaattcatt
ggaaatgaaccatttgccgtattacttggcgatgatattgtacaagcagaaacgccatgt
ttacgtcaattaatggatcaatatgaaggtacacaatcatcagttatcggtgtacaaaca
gtacctgaaaatgaaacacatcgttatggtattatcgatccagttgaacaaaacaatcgt
cgttatcaagtacgtcaatttgttgaaaagccagcagaaggtacagcaccatcaaattta
gcaattatgggtcgttacgtgttaacgccagaaatttttgtgttcctagagaatcaacaa
acgggtgctggtggagagattcagttaacagatgcaattcaaagattaaatgaaattcaa
cgtgtgtttgcttatgattttgaaggaactcgttatgatgttggggaaaagctaggattt
attaaaacaacagttgaattggcattaaaaaatagggaattaaggcaaaatctcttagag
tttatcaaaaaaaaattaaataatgatcgttaa

DBGET integrated database retrieval system