KEGG   Bacillus cereus Q1: BCQ_5185Help
Entry
BCQ_5185          CDS       T00852                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcq  Bacillus cereus Q1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCQ_5185 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCQ_5185 (atoB)
   00640 Propanoate metabolism
    BCQ_5185 (atoB)
   00650 Butanoate metabolism
    BCQ_5185 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCQ_5185 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BCQ_5185 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCQ_5185 (atoB)
   00310 Lysine degradation
    BCQ_5185 (atoB)
   00380 Tryptophan metabolism
    BCQ_5185 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCQ_5185 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCQ_5185 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCQ_5185 (atoB)
Enzymes [BR:bcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCQ_5185 (atoB)
Exosome [BR:bcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCQ_5185 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5050263..5051444)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVVDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHNEGRFEEEIVPVTIPQRKGDPIVVAKDEAPRADTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccagttggaaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggagggattgcaattaaagcggcgcttgaaaga
gcaaatgtttctgctagtgatgttgaggaagttatattcggaacggttattcaaggtggg
caggggcaaattccatcgcgccaagcggcgagggctgctggaatcccttgggaagtgcag
acggaaacagtgaataaagtttgtgcatcggggcttcgtgcggttacgttagcggatcaa
attattcgtactggcgatcaatcattgattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatatagaatgggcaacaacgaagtcgtt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccaccagcgtgcggtttcagcacataatgaaggacgttttgaagaggaaatcgtg
ccagtaacgattccgcaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgcca
cgcgcggatacaacaattgaaaagttagcaaaattaaaacctgtatttgataaaacagcg
acagtgacagctggtaatgcaccaggcttaaacgatggtggtgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggtaagacaattgaagacatcgatttattcgagattaatgaagcattt
gcagcagtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtagcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system