KEGG   Bacillus cereus AH187: BCAH187_A0118Help
Entry
BCAH187_A0118     CDS       T00799                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bcr  Bacillus cereus AH187
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bcr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
103083..104540
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagagctagaagcagaacgcgaa
gggcaaattgctcgtggtgaaacacctcgttacgcaggtaaccaccgtgatttaactgaa
gcgcaagtgaaagaatttgaagctgagggacgtattccaagtattcgtttccgcgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccactcaaat
gatttcggtgatttcgttatcgtgaaaaaagatggaattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtacttcgtggtgatgaccatatttca
aacacgccaaaacaaatgatgatttatgaagctttcggttgggatattccgcaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcactactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgtttgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtggtagaatta
agcttaccgcatttagtgaaggctggacgtataggtgaaactttaagtgaacaagaacaa
gcttggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcatgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcaattaaggcggctattaaagcagttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactactggtcaaacacac
ggtccagagcttcctaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

DBGET integrated database retrieval system