KEGG   Bacillus cereus AH187: BCAH187_A0198Help
Entry
BCAH187_A0198     CDS       T00799                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00220  Arginine biosynthesis
bcr00330  Arginine and proline metabolism
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01130  Biosynthesis of antibiotics
bcr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCAH187_A0198 (rocF)
   00330 Arginine and proline metabolism
    BCAH187_A0198 (rocF)
Enzymes [BR:bcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCAH187_A0198 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACJ81687
UniProt: B7HQY7
Position
158371..159264
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgatgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtggatcatattatagaagaaggacgttttccacttgtattaggtggagatcatagtatc
gctattggtacattagctggtgttgcgaaacattataaaaacctaggtgttatttggtat
gacgcacatggcgatttaaatacagaagaaacttcaccatctggaaatattcatggtatg
tcacttgcagcaagtttagggtatggacatccgacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgaaatgaaggtattaaagtattttcaatgcacgagattgatcgtatg
ggtatgacggctgttatggaagaaacaatcgcgtatttatctcatactgatggtgtgcat
ttatcattagacttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcttatcttatcgtgaaagtcatttagcaatggagatgttagcggaagctgat
attgttacatctgccgagtttgttgaggtaaatacgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system