KEGG   Bacillus cereus AH187: BCAH187_A0363Help
Entry
BCAH187_A0363     CDS       T00799                                 

Gene name
purB
Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
bcr  Bacillus cereus AH187
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcr00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320452..321759
Genome map
AA seq 435 aa AA seqDB search
MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDVKKIREHASFDIDRIY
EIEKETRHDVVAFTRAVSETPALGEERKWIHYGLTSTDVVDTALSYILKQANEIILKDLE
NFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEMKRNVERFKQAANTVRVG
KLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHAHYMSTLALIATSIEKMAV
EIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTGLARVIRGYMMTAYENVPLW
HERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYPENMKRNMTRTYGLIYSQRVM
LTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADERITSKLTQEEINECFNYEHHM
QHVDTIFERLGLNEA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattagtcgttatacacgcccagaaatgggtgcaatttggacggaagagaacaaattt
aaagcgtggttagaagttgagattttagcttgtgaagcatgggctgagcttggcgatatt
ccgaaagaagatgttaaaaaaattcgtgagcatgcatcatttgatattgatcgtatttat
gagattgaaaaagagacacgtcatgacgtagttgcattcactcgtgctgtatcagaaaca
ccagcattaggcgaggaacgtaaatggattcattacggtttaacatctacagacgtagta
gatacagcgttatcttacattttaaaacaagcgaatgaaatcatattaaaagacttagaa
aactttgtaagtattttagctaacaaagcgaaagagcataaatacacgatcatgatggga
agaacacacggtgttcatgcagaaccaacaacattcggtttaaaacttggtctttggtat
gaagaaatgaaacgtaacgtagagcgtttcaaacaagctgctaatacagttcgtgttggt
aaattatctggtgcggttggtacatatgcaaatatcgatccattcgtagaaaagtatgtt
tgtgaaaacttaggattagaagcagcaccaatttcaacacaaacattgcaacgtgatcgc
catgcacattacatgtcaacacttgcattaatcgcaacgtctatcgaaaagatggcagtt
gagattcgtggtttacaaaagagtgaaacacgtgaagttgaagaagctttcgcaaaaggt
caaaaaggttcttctgcaatgccgcataagcgtaatccaattggatctgaaaatatgact
ggtttagctcgtgttatccgcggttatatgatgacagcttatgagaatgttccattatgg
catgagcgtgatatttctcactcttcagcagaacgcgtaattttaccagatgctacaatc
gcgttaaattacatgctaaaccgctttggtaatattgttaaaaacttaactgtataccca
gagaatatgaaacgtaatatgacaagaacatacggcttaatttattctcagcgcgtaatg
cttacgttaattgacaaaggtatggtgcgtgaagaagcttacgatatcgtacaacctaaa
gcaatggaagcttgggaaacacaagtacaatttaaagagcttgtagaagctgatgagcgt
attacgagcaagttaacacaagaagaaattaatgaatgcttcaactatgagcatcatatg
caacacgttgatacaatctttgaacgccttggattaaacgaagcgtaa

DBGET integrated database retrieval system