KEGG   Bacillus cereus AH187: BCAH187_A0442Help
Entry
BCAH187_A0442     CDS       T00799                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcr  Bacillus cereus AH187
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BCAH187_A0442
Enzymes [BR:bcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BCAH187_A0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408172..408813
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGDVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagcgagaagaaattgtagcgtatggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgggagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacgaagcctgaagatgtagttatatta
aacttagatggcgatgtagtagagggagagagaaaaccatcaagcgaacttgatatgcat
cttatttattatagaaagcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcaaagacgattgcatcattaggatgggaactgcccgcagtatcgtatttaattgctttc
gcaggcccaaatgttcgttgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gcggctttcgaagggatgattgatcgtcgtgccgttttacttgcgaaccacggtttaatt
gcaggtgcaaatcatataaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatggacagcagtag

DBGET integrated database retrieval system