KEGG   Bacillus cereus AH187: BCAH187_A1232Help
Entry
BCAH187_A1232     CDS       T00799                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcr  Bacillus cereus AH187
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153474..1154895
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIIGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNEAGQSFILVNNRLHKMPNGSMMGIPTQITPFLF
SRLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGIFQTVKTGLESIVESLEAKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNI
PSTSVANVAMVFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRPGDEAVVEQTEEELVQLVLEDLRKTMDITENPEFTVVSRWKEAMPQYTVGHSERMKK
LTTFMEKELPGIYLAGSSYAGSGLPDCIDQGERAAKRVLSHLEKVMNTELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcatcggcggaggcatcactggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattactgatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgagcgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatgaggccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgaatggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccaggctgttctccccaattggtaaactaagagctggttttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcgggcactttttcagacatcgcctcggaaatgaa
gtggttgaaaatttaatagaaccattactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctgaaccgaaaaaaggaatc
ttccaaacagtgaaaacaggtttagaatctattgtagaatctctcgaagcaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcaaaacagggtgatggctat
acgattactcttagtaacggaaaagaaatagaagcggacgcggtcgtagtggcaagttca
cataaagtattgccatctatgtttgcacagtacaagcagtttcgtttcttccgcaacatt
ccgtccacatcagttgcgaatgtagcaatggttttcccgaaatcagccattcagcgagat
attgatggtacaggatttgttgtctctcgaaatagtgattacacaattacagcatgtacg
tggacgcataaaaagtggccacatacaacgccagaaggaaaaacgcttcttcgatgttac
gttggacgacctggtgatgaagcagttgtagaacaaacagaagaggaactcgttcagctc
gtactagaagacttacgaaagacgatggatattacagagaatccagagtttacagtcgta
agccgttggaaagaagcaatgccccaatatacagtaggccatagcgagcgaatgaagaaa
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagttcttacgct
ggttctggtctgccggactgtattgatcaaggtgagagggctgcaaagcgtgtactctct
catttggagaaagtaatgaatacggaattaatcgcacagtaa

DBGET integrated database retrieval system