KEGG   Bacillus cereus AH187: BCAH187_A1286Help
Entry
BCAH187_A1286     CDS       T00799                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcr  Bacillus cereus AH187
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH187_A1286 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAH187_A1286 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCAH187_A1286 (aceB)
Enzymes [BR:bcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCAH187_A1286 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207457..1209046
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLPGEMLPAYNEILTPEALSFLKELHGNFNERRIELLQKRAEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYHLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESHLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKGFRNHNQFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRLNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacattgcccggagaaatgttgccagcgtacaacgaa
atattgacacctgaggcgcttagttttttgaaggaactacatggaaatttcaatgagcgc
cgcatagaacttttacaaaagcgtgcggagaaacaaaagagaattgatgcaggggagttt
ccgaagtttttagaagaaacgaagcacatacgtgaagctgattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggcccggtagatagaaagatggtt
attaacgctttaaattcaggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcgattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcatttaaatagtaaaacagcagtatta
attgtgcgtccaagaggatggcatttagaagaaaaacatatgcaagttgacggaaagaat
atgtctggtagcttagtagattttggactttattttttccataatgcgaaagctctttta
gcaaaaggaagcggtccatacttttacttaccgaaaatggaaagccatttagaagcaagg
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaacggaacgatc
aaagccacggtgttactggaaacgatacatgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaagggtttccgtaatcataatcaatttttacttccagatagagcgcaagtcacgatg
acggcgccatttatgcgcgcgtattctttgaaagtcattcaaacatgtcaccgtcgtaat
gcaccagctattggaggaatggcagcacaaattccaattaaaaacaatccagaagcaaat
gaagcagcttttgaaaaagttcgtgcggataaggagcgcgaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtaccagtcgcgatggaagtatttaatcacatt
atgaaaacgccgaatcaaatttttagaaaacgtgaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtctgaatattagcgta
ggtattcaatatattgcatcttggttaagcggccgaggagcagcaccaatttataactta
atggaagatgcagcaacagcggaaatttctagggcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagctaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccgggttatgaaattttataa

DBGET integrated database retrieval system