KEGG   Bacillus cereus AH187: BCAH187_A1398Help
Entry
BCAH187_A1398     CDS       T00799                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCAH187_A1398 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH187_A1398 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAH187_A1398 (trpB)
Enzymes [BR:bcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCAH187_A1398 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1310817..1312010
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEEFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcaatggaa
gatgaagagtttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaacg
ccgctttatttcgctgagaatatgacggagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaataatacaatcggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgctctactcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagctgcaggtagcggtacattaaaagatgcggtaaacgaggcacttcgttac
tgggtttcacacgtgcatgatacgcactatattatgggatctgttctcggaccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaagcattagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatgggtatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggagttcatacagaaaagcatgcagctactttaacgaaaggaagcgtt
ggcgttctccacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gctcactctatttcggcgggacttgattaccctggtgttgggccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaagcgttagaagcattt
caattattaacgaaaaaagaaggaattatcccggcgttagaaagctcgcatgctgtcgcg
tacgctttaaaattagcgccgcaaatgaagaaagacgaagggcttgtcatttgtttatct
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system