KEGG   Bacillus cereus AH187: BCAH187_A1399Help
Entry
BCAH187_A1399     CDS       T00799                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00260  Glycine, serine and threonine metabolism
bcr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01130  Biosynthesis of antibiotics
bcr01230  Biosynthesis of amino acids
Module
bcr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH187_A1399 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAH187_A1399 (trpA)
Enzymes [BR:bcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCAH187_A1399 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: ACJ78439
UniProt: B7I0F3
Position
1312014..1312790
Genome map
AA seq 258 aa AA seqDB search
MGVEKMKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDGGVTLKGIFQALAEVRKEVQIPFVLMTYLNPVLAFGKEHFIERCLEAGV
DGIIVPDLPYEEQDIIAPLLRTANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTNLPVVAGFGISTKEHVEEMITICDGVVVGSKIIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaatgaaagcagcatttgaaaatggcaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaaattaaaagaaagaattcgttttcttgatgaa
gcaggagcaagcatcgttgaaattggtatcccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatggcggtgtaacattaaagggcattttt
caagcgttagcagaagtaagaaaagaagtacaaattccttttgtactcatgacatactta
aatccagtacttgcattcggaaaagaacacttcattgagagatgcttagaagcaggtgtg
gacggtattatcgttccagacttaccgtatgaagaacaagatattattgcaccgcttctc
cgaactgcaaatatcgctttaatcccactcgttaccgttacgagcccaattgagcgaatc
gagaaaattacgagtgaatcagaagggttcgtctacgctgttacagtagcaggcgtaaca
ggcgtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacat
acaaatttaccggtagtagcagggttcggtatttcaacaaaggaacatgtagaagaaatg
attacaatatgtgacggggttgtcgttggaagtaaaattattgaactgttagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcataa

DBGET integrated database retrieval system