KEGG   Bacillus cereus AH187: BCAH187_A2056Help
Entry
BCAH187_A2056     CDS       T00799                                 

Definition
D-alanyl-D-alanine carboxypeptidase family protein
Orthology
K01286  
D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bcr  Bacillus cereus AH187
Brite
Enzymes [BR:bcr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BCAH187_A2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1918030..1918983
Genome map
AA seq 317 aa AA seqDB search
MKRLKWGRLTVLLVIVLGICWFLFQGTQKSATSIEGQPLQVAELPKTGLVEKVVPPKYIP
PEIDAKAAMIIDASNGDIIYQHNENEAFAPASMSKMMTAYLLLENVHNGKVRWEDPVKMS
AKAAQTEGARIPVQVNDTLTVKDLYHALMIESANNSAVALAEHMAKSEKDFVQLMNAKAK
QLKMSEHAKFANASGLQEPDGSETKMTAGDVANLAYHLIKDYPEILEVTHLRQSQLAFNN
INVISTNDMLNKNNKALYIEGIDGLKTGFTDSAGYCFTGTAKQGDTRIITVVMGTKGKTK
RFTETNKLMSYAFGLVN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggttaaaatggggaaggctgacagtcctattagtcattgttttagggatatgt
tggttcttattccaaggaactcaaaagagtgcaacaagtatagagggacaacctttacaa
gtggcagaactacctaaaacaggattagttgaaaaagtagtcccaccaaagtacatacca
ccggaaattgatgcaaaagcagctatgattattgatgcgagtaatggagatattatttat
caacataatgaaaatgaggcttttgcgccagcaagtatgtctaagatgatgacagcatat
cttctattagaaaatgtacataatgggaaagttcgctgggaagatccggtgaaaatgagt
gcgaaagcggcacaaacagagggagcgagaatcccagtacaagttaatgacacattaact
gttaaagatttatatcatgcattaatgattgagtcagctaataattcagctgtggcttta
gcagaacatatggcaaaatcggagaaagatttcgttcagcttatgaatgcaaaagcgaaa
cagttaaaaatgtcggaacatgctaaatttgcaaatgcttctggattacaagagcccgat
ggaagtgaaacaaaaatgacggctggtgatgtagcaaacttggcgtatcatcttataaaa
gattacccagaaatattagaagtgactcacttacgtcaaagtcagttagcatttaataat
attaatgttataagtacaaatgatatgttaaacaaaaataataaagctttatatatagaa
ggaatagacggattaaaaacaggatttacagatagcgcagggtattgttttacgggtaca
gcaaaacaaggtgatactcgtattattacagttgttatggggacaaaaggtaaaacaaag
cgttttacagagacgaataagctaatgtcttatgcatttggcttagttaattaa

DBGET integrated database retrieval system