KEGG   Bacillus cereus AH187: BCAH187_A2175Help
Entry
BCAH187_A2175     CDS       T00799                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00010  Glycolysis / Gluconeogenesis
bcr00260  Glycine, serine and threonine metabolism
bcr00680  Methane metabolism
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
bcr01230  Biosynthesis of amino acids
Module
bcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcr_M00002  Glycolysis, core module involving three-carbon compounds
bcr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A2175
  Energy metabolism
   00680 Methane metabolism
    BCAH187_A2175
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH187_A2175
Enzymes [BR:bcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH187_A2175
Membrane trafficking [BR:bcr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCAH187_A2175
Exosome [BR:bcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH187_A2175
  Exosomal proteins of melanoma cells
   BCAH187_A2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF5317
Motif
Other DBs
NCBI-ProteinID: ACJ82223
UniProt: B7HP03
Position
2037275..2037865
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGEMLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEMDGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatatcttaaacgtacatgaa
ggacgagctgattttgaattgacagaaaagggaagacagcaagtgcaaaggcttgtacag
aaagtgaaagcagatttcccgccagatttcatttgggcaagtacattaaaacgggctcgc
gaaacaggtgaaatgttagcagaaggaattggatgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcctttgaagaagcaaagaaataccca
gagccaaagttccttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggaatcttttctaaaatcgtgacagagaatacatatgaccgaattgcaatt
gttgcacatggtggtgtaataaatagtctattacgtgcttttttcaaaatgcccatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaatggatggcgaa
caaaaaacagtacatttcattaatgatacgaatcatttggacgggatgtaa

DBGET integrated database retrieval system