KEGG   Bacillus cereus AH187: BCAH187_A2349Help
Entry
BCAH187_A2349     CDS       T00799                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bcr  Bacillus cereus AH187
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAH187_A2349 (dfrA)
   00670 One carbon pool by folate
    BCAH187_A2349 (dfrA)
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BCAH187_A2349 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192378..2192866
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHA
FEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagtttcatttatggtcgcaatggacgagaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattacaatatgtaaagaaaacaacgatgggtcatccg
cttattatgggaagaaagaactatgaagcgattggtagaccactgcctggaagacgtaat
attattgtaactcgcaatgaagggtatcatgttgaaggatgtgaagtagcacattctgta
gaagaagtgtttgagctatgcaaaaatgaagaagagatctttatttttggcggagcacaa
atttatgatctctttttaccttacgtagacaagttatatataacaaaaatccatcatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagaagtttttgtt
gaaaaaggtttaacggatgaaaaaaatccgtatacgtactattatcatgtatatgagaag
caacaatag

DBGET integrated database retrieval system