KEGG   Bacillus cereus AH187: BCAH187_A2378Help
Entry
BCAH187_A2378     CDS       T00799                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCAH187_A2378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A2378
  Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A2378
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH187_A2378
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAH187_A2378
   00626 Naphthalene degradation
    BCAH187_A2378
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAH187_A2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2217471..2218508
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGIGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSNIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQDEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagcaaacattgaagttattgaaaaggaa
ttacgtccgttacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcgaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtataggtattgtgacgaagattgctgatgatgttacgtcactaaaggtgggagac
cgtgtaagtattgcatggatgttccaatcttgtgggcgttgcgaatattgcgtaacaggt
agggaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgtgacagctgattatgcggtgaaagtaccagaaggattagatccagct
caagcatcatcaatcacatgtgcgggtgtaactacatataaagctataaaagtatcaaat
attaaacctggccaacctatcgtcatctatggttgtggtggattaggtaacctagctatt
caatatgctaaaaacgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ttagccttagcaaaagaggttggagctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattgttcaagatgagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaagtagcattcaactctgcagttgatgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaacgatggatttaaatattccgcgacttgtactagatggaatt
gaagtggttggctctctagtcggtactcgtaaggatctagaagaggcatttatgttcggt
gcagaaggaaaagtagtgcctgttgttcaaacttgttctctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtcgaattcaaggacgtatggtaatcgattttaaacagcat
aattgtgattgcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system