KEGG   Bacillus cereus AH187: BCAH187_A2583Help
Entry
BCAH187_A2583     CDS       T00799                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH187_A2583 (gpmA)
   01230 Biosynthesis of amino acids
    BCAH187_A2583 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A2583 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCAH187_A2583 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH187_A2583 (gpmA)
Enzymes [BR:bcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH187_A2583 (gpmA)
Exosome [BR:bcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH187_A2583 (gpmA)
  Exosomal proteins of melanoma cells
   BCAH187_A2583 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2412789..2413526
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSEKGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGEFPLTECLVDTEKRVLAYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHITF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaaaggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaacggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggatcttgcctgggtgccagtacat
aaatgttggaagctaaatgaaagacattatggtgcattgcaagggttgaataaagatgaa
accgcgcaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcccaggtatgaaatgaatgatccaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gtcgtttcattaaatattccaacgagcataccactcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggagaaattccg
aaacatattactttttaa

DBGET integrated database retrieval system