KEGG   Bacillus cereus AH187: BCAH187_A2642Help
Entry
BCAH187_A2642     CDS       T00799                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00010  Glycolysis / Gluconeogenesis
bcr00071  Fatty acid degradation
bcr00350  Tyrosine metabolism
bcr00625  Chloroalkane and chloroalkene degradation
bcr00626  Naphthalene degradation
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A2642
  Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A2642
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH187_A2642
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAH187_A2642
   00626 Naphthalene degradation
    BCAH187_A2642
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAH187_A2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACJ81382
UniProt: B7HSA5
Position
2465992..2466918
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYNGSDVTDTHPIYP
RKTGYESYGEVIQVGNKVKNLNIGDKVVSFYGHETIGVVNGYKVIRVPSYIKPKVALLSI
LSCDAAKGILKLNPRQDEKVLITGMGVIGLLTCYFLKYYIGVEHVDIVEPDRNRREFAQK
FSVKNTFDAEEQIVETYNYGFECSATNSGFHTLQKTLKTNGQICILSDGNIEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEKTPWIEEIFQHEIQHTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagcatt
ggagcagagttacctcagtataatggatccgatgttacagatacacaccctatttatcca
agaaaaactggatatgaaagttacggtgaagtgattcaagttggtaataaagtaaagaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggagtagttaat
gggtataaagtaattcgagtacctagttatataaaacctaaagtagctttattatctatt
ctttcgtgtgatgctgctaaaggtatattgaaactaaacccgcgacaggatgaaaaggta
cttataactggaatgggagttatcggtttacttacttgttatttcttaaaatactatata
ggtgttgagcatgtggatattgttgaacctgatagaaatagaagggaatttgcacagaaa
tttagtgtaaaaaacacatttgatgcagaagaacagatagtagaaacatataattatggt
ttcgaatgttctgctacaaatagtggattccatacattacaaaaaacacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaaaaaacaccatggatagaagagatttttcaacatgaa
atacaacatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system