KEGG   Bacillus cereus AH187: BCAH187_A2642Help
Entry
BCAH187_A2642     CDS       T00799                                 

Definition
zinc-binding dehydrogenase family oxidoreductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCAH187_A2642
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A2642
  Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A2642
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH187_A2642
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAH187_A2642
   00626 Naphthalene degradation
    BCAH187_A2642
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAH187_A2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2465992..2466918
Genome map
AA seq 308 aa AA seqDB search
MEQNKLVLEGPKRLKWETREIKSIQNDEIIVKTIAGAISIGAELPQYNGSDVTDTHPIYP
RKTGYESYGEVIQVGNKVKNLNIGDKVVSFYGHETIGVVNGYKVIRVPSYIKPKVALLSI
LSCDAAKGILKLNPRQDEKVLITGMGVIGLLTCYFLKYYIGVEHVDIVEPDRNRREFAQK
FSVKNTFDAEEQIVETYNYGFECSATNSGFHTLQKTLKTNGQICILSDGNIEELTLTADF
YEKELRIIGSSDGYNYQQHADWFFSQIEKTPWIEEIFQHEIQHTGLIQCFEELSQGIITP
LKVFVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaattagttttagaaggaccaaaacgtcttaagtgggaaacgcgcgaa
attaagtctatacagaatgatgaaattatcgttaaaacaattgcaggtgcaataagcatt
ggagcagagttacctcagtataatggatccgatgttacagatacacaccctatttatcca
agaaaaactggatatgaaagttacggtgaagtgattcaagttggtaataaagtaaagaat
ttaaacataggcgataaagtagtttctttttatggacatgaaacgataggagtagttaat
gggtataaagtaattcgagtacctagttatataaaacctaaagtagctttattatctatt
ctttcgtgtgatgctgctaaaggtatattgaaactaaacccgcgacaggatgaaaaggta
cttataactggaatgggagttatcggtttacttacttgttatttcttaaaatactatata
ggtgttgagcatgtggatattgttgaacctgatagaaatagaagggaatttgcacagaaa
tttagtgtaaaaaacacatttgatgcagaagaacagatagtagaaacatataattatggt
ttcgaatgttctgctacaaatagtggattccatacattacaaaaaacacttaaaactaat
ggacaaatatgtatactttctgatggtaatattgaagaactaacattaaccgctgatttt
tatgagaaagaactgcggatcattggttcaagtgacggatataattatcaacaacatgca
gattggttttttagtcaaatagaaaaaacaccatggatagaagagatttttcaacatgaa
atacaacatacaggactcattcaatgttttgaggaattaagtcaaggaataattacccct
ttaaaagtatttgtctcatatgaataa

DBGET integrated database retrieval system