KEGG   Bacillus cereus AH187: BCAH187_A2647Help
Entry
BCAH187_A2647     CDS       T00799                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bcr  Bacillus cereus AH187
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BCAH187_A2647
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCAH187_A2647
Enzymes [BR:bcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BCAH187_A2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469893..2470651
Genome map
AA seq 252 aa AA seqDB search
MNADDPSVEYFKKITSAEVITYGIHNGADVQAKNITLRPKGIRFLVSSFNGEIEVNLNLV
GRFNVYNALAAITVAMVEGIPLTNICDSLSNLKSIEGRMEIIDENQDFLVIVDYAHTPDA
LENVLSTISEFSKGKVITVFGCGGDRDAKKRSIMGGIAGSYSDFVFITSDNPRSEDPQAI
MKDIEKGFLQNNNLNYKVEVDRELAINHAINMASSNDIVLIAGKGHETYQILKDSTIHFD
DKEKARQAIINK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcagatgatccgtcggtagaatactttaaaaaaattacttcagccgaggttatc
acatatggaatacataatggagcagatgttcaagcgaagaacataactttaaggccaaaa
ggaattcgttttttagtttcgtcctttaatggagaaatagaggttaaccttaatcttgta
ggtcgttttaatgtttataatgcattagcagcaataacagttgcaatggttgaaggtatc
ccgcttacaaacatttgcgatagcttatctaacttaaagagtattgaaggtagaatggaa
attatagatgaaaatcaagattttcttgtaatagtggactatgctcatacaccggatgcg
ttagaaaatgttctctctacaattagcgagttttcaaaaggtaaagttattactgttttc
ggttgtggtggggatagagatgcaaaaaaacgatctatcatgggtggaattgctggaagt
tatagcgattttgtttttattacttctgacaatccacgttcggaagatccgcaggcaata
atgaaagatattgaaaaaggatttttgcagaataataatttgaattataaagtagaagta
gatcgtgaacttgcaataaatcacgcaataaacatggcatcttctaatgatattgttttg
attgcaggaaaagggcatgaaacgtatcaaattttaaaagattcaactattcattttgat
gataaagaaaaagctcgacaagcaattattaataaatga

DBGET integrated database retrieval system