KEGG   Bacillus cereus AH187: BCAH187_A3250Help
Entry
BCAH187_A3250     CDS       T00799                                 

Gene name
cypD
Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bcr  Bacillus cereus AH187
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A3250 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BCAH187_A3250 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCAH187_A3250 (cypD)
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BCAH187_A3250 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BCAH187_A3250 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3023458..3026655)
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETSHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGNQEENDLLSR
MLHVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLEKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEDYQLDVKQTLTLKPGDFKIRIVPRNETISHNTVLAPTEEKLKNDETKQ
QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKSFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMATFTVCPPHKKELESLLEEGVYQEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFQLPENLETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGCRHPEKDYL
YRTELENDEREGLISLHTAFSRLEGHPKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgccattccccagccgaaaacatatggaccgctagggaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcagaagagtatggt
cctatttttcaaattcaaactttgagtgataccatcattgtcgtttctggacatgaactg
gtagcggaagtttgtgatgaaacaagatttgataaaagtatagagggtgctttagcaaag
gttcgtgcctttgctggagacggattatttacaagcgagactgacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagtcaacgggcaatgaaagattatcatgct
atgatggtcgatattgccgtgcaactcgttcaaaaatgggcaagactgaatccgaatgaa
aatgtagatgtcccaggggatatgactcgccttacattagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacctctcatccttttatcactagcatg
acccgtgctctagatgaggcgatgcaccaattgcagcggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggaaatcaggaagaaaatgatttactttcccgt
atgttacatgtgcaggatccggaaacgggtgaaaaattagatgatgaaaatattcgtttt
caaattatcacttttttaatagctgggcatgaaacaacaagtggattgttatcttttgca
atctattttttattaaagaatccggataaattggaaaaagcctatgaagaagtagaccgt
gttttgacagatcccactccaacataccaacaagttatgaagcttaagtatatacggatg
attttaaatgaatcactacgtctatggccgactgctccagcattcagtctctatgcgaaa
gaagatacagtgattggtgggaaatatccaattaagaaaggagaggatcgtatttctgtc
cttattccacagctacatagggataaagatgcgtggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataaaccatttggaaat
ggtcagcgagcatgtatcggtatgcagtttgcacttcatgaagccacactcgtaatggga
atgcttcttcaacattttgaattcatcgattatgaagactatcagctggacgtaaaacaa
acattaacgctaaagcctggtgattttaaaattaggattgtacctcgaaatgaaactatt
agccataatactgttcttgcgcctacagaggagaaactgaaaaacgatgaaaccaagcag
caagttcagaaaactccttctattattggagccgataatctttcgcttcttgttctgtat
ggctcggatacaggggtagcagagggcattgcaagagaactagcagatacagctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccgaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaagaattaaaaccagatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacttatcagcgaattccaagatacattgat
gagcaaatggctcaaaaaggagcaacaaggttttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaagtatgtggtctgatgcgatgaag
tcatttggattggaacttaacaaaaacatggagaaagaacgcagtactttgagcctgcaa
tttgtcagccgtcttggaggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atattagaaaatcgtgaacttcaatcatctagcagtgaaagaagtacgcgacatattgag
atatcattgccagaaggcgctacatataaagaaggagaccaccttggggtactgccaatt
aatagtgagaaaaatgtcaaccgaattttaaaacgctttggattaaacgggaaggatcaa
gtcattttaagcgcaagtgggcgcagtgtaaatcatatacctttagacagtcctgttcgt
ttatatgaccttcttagttatagtgtcgaagtgcaagaagcagctactcgtgcacaaata
cgagaaatggcgacattcacagtatgccctcctcataaaaaggaattggaatcattattg
gaagagggagtttatcaagaacaaatattaaagaaacgtatttcaatgttagatcttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttccggcgctc
aaaccgcgttactattctatctcaagttctccacttgttgcccaggatcgtctgagcatt
acggttggtgttgtaaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttcaattacctgaaaatctagaaacaccaattatcatggttggaccaggc
actggaattgcaccattccgtggattcttacaagcgcgtcgtgttcaaaagcaaaaaggt
atgaaggtaggagaagcacatctatactttggttgtcgtcatcctgaaaaggattatctc
tatcgtacagaattagaaaatgatgaaagagagggattaatctctttacacacagctttt
tctcgcttagaaggacatcctaaaacatatgtacagcatgtaataaaagaagatagaatc
catttaatttcgttattagataatggggcccatctttatatatgtggtgatggaagtaaa
atggctcctgacgtagaagataccctttgtcaagcctatcaagaaattcatgaagttagt
gaacaagaagcaaggaattggttagatcgtttgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system