KEGG   Bacillus cereus AH187: BCAH187_A3883Help
Entry
BCAH187_A3883     CDS       T00799                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase (ADP-forming), beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00020  Citrate cycle (TCA cycle)
bcr00640  Propanoate metabolism
bcr00660  C5-Branched dibasic acid metabolism
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
Module
bcr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAH187_A3883 (sucC)
   00640 Propanoate metabolism
    BCAH187_A3883 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BCAH187_A3883 (sucC)
Enzymes [BR:bcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BCAH187_A3883 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACJ81770
UniProt: B7HLG9
Position
complement(3640450..3641610)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcggcgaaagaattaggaacg
gatgtatgtgtagtgaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagaccgtgcaacttctcaa
gttgttttaatggcttctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
cctgaaaaaatctttaaagaatatattgatccagcagtaggcttacaaggcttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcttttatcgaaaaagattgctctatcgcagagattaaccca
cttgttacaacaggtgatggtaaagttatggcattagatgcgaaattaaactttgattct
aatgctttatatcgccataaggacattttagaacttcgtgaccttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctactatggatatcattaaacattaccat
ggcgatccagctaactttttagatgttggtggcggtgcgacagctgaaaaggttacagaa
gcattcaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgtagagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system