KEGG   Bacillus cereus AH187: BCAH187_A4170Help
Entry
BCAH187_A4170     CDS       T00799                                 

Definition
putative 5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bcr  Bacillus cereus AH187
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bcr00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3888210..3888722
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEINTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLKENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaaataaatactcgcattgaaaatgaagtggaagtatca
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttccaaacttcctact
catttaaaagaaaattactcattaacagatgaaaacaaagctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcacgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaattttcaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system