KEGG   Bacillus cereus AH187: BCAH187_A4265Help
Entry
BCAH187_A4265     CDS       T00799                                 

Gene name
argJ
Definition
(GenBank) glutamate N-acetyltransferase/amino-acid acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00220  Arginine biosynthesis
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01130  Biosynthesis of antibiotics
bcr01210  2-Oxocarboxylic acid metabolism
bcr01230  Biosynthesis of amino acids
Module
bcr_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCAH187_A4265 (argJ)
Enzymes [BR:bcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BCAH187_A4265 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     BCAH187_A4265 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ DUF555
Motif
Other DBs
NCBI-ProteinID: ACJ80268
UniProt: B7HNP8
Position
complement(3967991..3969214)
Genome map
AA seq 407 aa AA seqDB search
MIKVASITKVENGSIVTPKGFSAIGNAIGLKKEKKDLGAIICDIPASCAAVYTTNQIQAA
PLQVTKDSITTEGKLQAIIVNSGNANACTGMKGLQDAYEMRALGAKHFGMKDNYVAVAST
GVIGVPLPMDIIRNGIATLIPAKEEREAHSFSEAILTTDLITKETCYEMVIDGKKVLIAG
VAKGSGMIHPNMATMLSFITTDAHIEHDVLQTALSQITNHTFNQITVDGDTSTNDMVIVM
ASGLSETKPIDMEHADWETFIFALQKVCEDLAKKIAQDGEGATKLIEVNVLGARTNEEAK
KIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVTINPNTIDITLQSIAVLKNSEPQMF
SEEEMKMRLQEHEIMIDVYLHLGEETGSAWGCDLSYEYVKINACYRT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagcgtctattacaaaagtagaaaatggttcgattgtaactccaaaaggt
ttctcggccattggcaatgcaattggtttgaaaaaggagaaaaaggatttaggggcaatc
atttgtgatataccagcatcatgtgctgctgtttatacaacaaatcaaatacaagcagct
cccttgcaagtaacgaaggatagtataacgactgaggggaaattacaagctattatcgtc
aatagtggaaatgcaaatgcttgtacgggaatgaaaggattacaagatgcttatgagatg
cgtgcattaggggcgaaacattttggaatgaaagacaattacgttgcagtagcttcaaca
ggtgtaattggtgttccgctgccgatggatataatccgaaatgggattgctactcttatc
ccggcgaaggaagaaagggaagctcattctttttctgaagcgatcttaacgacggatctt
ataacgaaagaaacttgctatgaaatggtgattgatgggaagaaagtgctgattgctggt
gttgcgaaaggttcagggatgattcatccaaatatggcaacgatgctaagttttattacg
acagacgctcatatagagcatgacgtattacaaacagcattatcacaaatcacgaatcat
acattcaatcaaattacggtggatggcgatacttctacgaatgatatggtcatcgttatg
gcaagtggattatcagaaacgaaaccaattgatatggaacatgcagattgggaaactttc
atatttgctttacagaaggtatgtgaagatttagcgaaaaaaattgcacaagatggtgaa
ggcgctacgaagttaatagaagtaaatgtgttaggagctcgaacgaatgaagaggcaaaa
aaaattgcaaagcaaatagtcggttcgagtcttgtgaaaacagcaatacatggtgaagat
ccaaactgggggcgaattattagtagcattggacaaagtgaagtcacgattaacccaaat
acaattgatattactcttcaatctattgcggtgctgaaaaatagtgaacctcaaatgttt
tctgaagaggaaatgaaaatgaggttacaagaacatgaaattatgattgatgtgtattta
catttaggagaagagaccggatcagcttggggctgtgacttaagctatgaatatgtgaaa
ataaacgcttgttatcgtacataa

DBGET integrated database retrieval system