KEGG   Bacillus cereus AH187: BCAH187_A4265Help
Entry
BCAH187_A4265     CDS       T00799                                 

Gene name
argJ
Definition
bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein (EC:2.3.1.35)
Orthology
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BCAH187_A4265 (argJ)
   01230 Biosynthesis of amino acids
    BCAH187_A4265 (argJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCAH187_A4265 (argJ)
Enzymes [BR:bcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BCAH187_A4265 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     BCAH187_A4265 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3967991..3969214)
Genome map
AA seq 407 aa AA seqDB search
MIKVASITKVENGSIVTPKGFSAIGNAIGLKKEKKDLGAIICDIPASCAAVYTTNQIQAA
PLQVTKDSITTEGKLQAIIVNSGNANACTGMKGLQDAYEMRALGAKHFGMKDNYVAVAST
GVIGVPLPMDIIRNGIATLIPAKEEREAHSFSEAILTTDLITKETCYEMVIDGKKVLIAG
VAKGSGMIHPNMATMLSFITTDAHIEHDVLQTALSQITNHTFNQITVDGDTSTNDMVIVM
ASGLSETKPIDMEHADWETFIFALQKVCEDLAKKIAQDGEGATKLIEVNVLGARTNEEAK
KIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVTINPNTIDITLQSIAVLKNSEPQMF
SEEEMKMRLQEHEIMIDVYLHLGEETGSAWGCDLSYEYVKINACYRT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagcgtctattacaaaagtagaaaatggttcgattgtaactccaaaaggt
ttctcggccattggcaatgcaattggtttgaaaaaggagaaaaaggatttaggggcaatc
atttgtgatataccagcatcatgtgctgctgtttatacaacaaatcaaatacaagcagct
cccttgcaagtaacgaaggatagtataacgactgaggggaaattacaagctattatcgtc
aatagtggaaatgcaaatgcttgtacgggaatgaaaggattacaagatgcttatgagatg
cgtgcattaggggcgaaacattttggaatgaaagacaattacgttgcagtagcttcaaca
ggtgtaattggtgttccgctgccgatggatataatccgaaatgggattgctactcttatc
ccggcgaaggaagaaagggaagctcattctttttctgaagcgatcttaacgacggatctt
ataacgaaagaaacttgctatgaaatggtgattgatgggaagaaagtgctgattgctggt
gttgcgaaaggttcagggatgattcatccaaatatggcaacgatgctaagttttattacg
acagacgctcatatagagcatgacgtattacaaacagcattatcacaaatcacgaatcat
acattcaatcaaattacggtggatggcgatacttctacgaatgatatggtcatcgttatg
gcaagtggattatcagaaacgaaaccaattgatatggaacatgcagattgggaaactttc
atatttgctttacagaaggtatgtgaagatttagcgaaaaaaattgcacaagatggtgaa
ggcgctacgaagttaatagaagtaaatgtgttaggagctcgaacgaatgaagaggcaaaa
aaaattgcaaagcaaatagtcggttcgagtcttgtgaaaacagcaatacatggtgaagat
ccaaactgggggcgaattattagtagcattggacaaagtgaagtcacgattaacccaaat
acaattgatattactcttcaatctattgcggtgctgaaaaatagtgaacctcaaatgttt
tctgaagaggaaatgaaaatgaggttacaagaacatgaaattatgattgatgtgtattta
catttaggagaagagaccggatcagcttggggctgtgacttaagctatgaatatgtgaaa
ataaacgcttgttatcgtacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system