KEGG   Bacillus cereus AH187: BCAH187_A4513Help
Entry
BCAH187_A4513     CDS       T00799                                 

Gene name
udk
Definition
uridine kinase (EC:2.7.1.48)
Orthology
K00876  
uridine kinase [EC:2.7.1.48]
Organism
bcr  Bacillus cereus AH187
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BCAH187_A4513 (udk)
Enzymes [BR:bcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     BCAH187_A4513 (udk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4177348..4177986)
Genome map
AA seq 212 aa AA seqDB search
MGTNKPVVIGIAGGSGSGKTSVTKAIFDHFKGHSILILEQDYYYKDQSHLPMEERLKTNY
DHPLAFDNDLLIEHLQQLLAYKQVEKPVYDYTLHTRSDEIIPVEPKDVIILEGILILEDP
RLCELMDIKLFVDTDADLRILRRMQRDIKERGRTMDSVIDQYVNVVRPMHNQFIEPSKKF
ADIIIPEGGQNHVAIDIMVTKIATILEQKVNL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaataagcctgttgtaattggaattgctggtggttcagggtcaggtaagaca
agtgtaacgaaagcgatttttgaccattttaaaggtcattccattttaatcttagagcaa
gattattattacaaagatcaaagccatttaccaatggaagaacgtttaaaaacaaattat
gatcatccattagcgtttgataatgatttgttaattgaacatttgcagcagttgcttgca
tataaacaagtagagaaacctgtatatgactatacattgcatacgcgttcagatgaaatt
attccagttgagccgaaagatgtaatcattttagaaggaattcttattttagaagaccca
cgtctttgtgagttaatggacattaagttattcgttgatacagatgctgaccttcgtatc
ctgcgccgcatgcagcgtgatattaaagaacgtggtcgtacgatggattcagttattgat
caatatgtaaatgttgtacgtccaatgcacaatcaatttattgagccttctaagaaattt
gcggatattattatccctgaaggtggacaaaaccacgttgcaattgatattatggttaca
aaaattgcaacaattcttgaacaaaaagtaaatttgtaa

DBGET integrated database retrieval system