KEGG   Bacillus cereus AH187: BCAH187_A4513Help
Entry
BCAH187_A4513     CDS       T00799                                 

Gene name
udk
Definition
uridine kinase (EC:2.7.1.48)
Orthology
K00876  
uridine kinase [EC:2.7.1.48]
Organism
bcr  Bacillus cereus AH187
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4177348..4177986)
Genome map
AA seq 212 aa AA seqDB search
MGTNKPVVIGIAGGSGSGKTSVTKAIFDHFKGHSILILEQDYYYKDQSHLPMEERLKTNY
DHPLAFDNDLLIEHLQQLLAYKQVEKPVYDYTLHTRSDEIIPVEPKDVIILEGILILEDP
RLCELMDIKLFVDTDADLRILRRMQRDIKERGRTMDSVIDQYVNVVRPMHNQFIEPSKKF
ADIIIPEGGQNHVAIDIMVTKIATILEQKVNL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaataagcctgttgtaattggaattgctggtggttcagggtcaggtaagaca
agtgtaacgaaagcgatttttgaccattttaaaggtcattccattttaatcttagagcaa
gattattattacaaagatcaaagccatttaccaatggaagaacgtttaaaaacaaattat
gatcatccattagcgtttgataatgatttgttaattgaacatttgcagcagttgcttgca
tataaacaagtagagaaacctgtatatgactatacattgcatacgcgttcagatgaaatt
attccagttgagccgaaagatgtaatcattttagaaggaattcttattttagaagaccca
cgtctttgtgagttaatggacattaagttattcgttgatacagatgctgaccttcgtatc
ctgcgccgcatgcagcgtgatattaaagaacgtggtcgtacgatggattcagttattgat
caatatgtaaatgttgtacgtccaatgcacaatcaatttattgagccttctaagaaattt
gcggatattattatccctgaaggtggacaaaaccacgttgcaattgatattatggttaca
aaaattgcaacaattcttgaacaaaaagtaaatttgtaa

DBGET integrated database retrieval system