KEGG   Bacillus cereus AH187: BCAH187_A4780Help
Entry
BCAH187_A4780     CDS       T00799                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00010  Glycolysis / Gluconeogenesis
bcr00620  Pyruvate metabolism
bcr00640  Propanoate metabolism
bcr00680  Methane metabolism
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A4780
   00620 Pyruvate metabolism
    BCAH187_A4780
   00640 Propanoate metabolism
    BCAH187_A4780
  Energy metabolism
   00680 Methane metabolism
    BCAH187_A4780
Enzymes [BR:bcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAH187_A4780
Lipid biosynthesis proteins [BR:bcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAH187_A4780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACJ80731
UniProt: B7HSI2
Position
complement(4431916..4433502)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQPVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEGIP
VQVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaatcgccga
gaagttacatacgcggagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaagggggacaagctcctcattatgatgccgcgtttaattgaagcatac
atgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaaatgtta
cgcaaaaaggatatcgagtaccgcattggacatggggaagtaaaagcaatcgtaagttat
gagccgtacattggacagtttgatgatatagaagcgatggaatcccttcaaaaattcgtt
ctgagcgagcagccagtagatggatggatcaatttaaaaacagcgttagaaacagaaagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacgggaaatccaaaaggtgttgttcatacacatgcgtgggcatacgctcattta
cgtacgagcgctccaaattggctcggaattgaagagaatgatgttgtgtgggcaacagct
agtccaggctggcagaagtggatttggagcccgtttttagcaactctaggctcgggggca
acaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccgactgagtatagattaatggcaaaagtagaa
aatttaagtgaatacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaagcactttcatattacagtaagagacggctat
gggcaaacggaaaacacattgcttgttggtgtaatgaaaggaatggatattagaccagga
tcaatggggaaaccgacgccgggtaaccacgttgatattgtaaatgaggaaggtattccg
gtacaggtaggcgaagttggtgatattgcagttcacattgaaacgccggcactctttaaa
caatattacaaagacgatgagcgtacagcgatgcaattccgcggtgattattatattaca
ggtgataaagcgaaaaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttacgtgagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaagaacttactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgagcttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system