KEGG   Bacillus cereus AH187: BCAH187_A5063Help
Entry
BCAH187_A5063     CDS       T00799                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcr  Bacillus cereus AH187
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAH187_A5063 (gtaB)
   00052 Galactose metabolism
    BCAH187_A5063 (gtaB)
   00500 Starch and sucrose metabolism
    BCAH187_A5063 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAH187_A5063 (gtaB)
Enzymes [BR:bcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCAH187_A5063 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4678038..4678928)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQE
GRRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQTNQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagcaacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgatccaa
tacattgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaa
acaaagcgttctatcgaagatcattttgataacgcatttgaactagaacaaaacttattg
gagaagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatatt
cattacatccgtcaaaaagaaccgaaagggctaggacatgctgtttggtgtgcacgtaaa
ttcattggcgatgagccgtttgcagtgctactaggtgatgatattgtccaagctgagaaa
ccatgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgta
caaactgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaa
ggtcgtcgttaccaagttcgcaatttcgttgagaagccagcgcaaggtacagcaccttca
aacttagcgattatgggacgttacattttaacgcctgaaatctttatgttcttagaacag
caacatgttggtgctggtggcgaaattcagttaacagatgctatccaaagtttaaacgaa
attcaacgtgtattcgcttacgacttcgaaggaaagcgctacgacgtaggtgaaaagtta
ggatttgttcaaacaacaatcgaaatggcactgcaacacccagaattacgtgatgacatg
gttgcaatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system