KEGG   Bacillus cereus AH187: BCAH187_A5112Help
Entry
BCAH187_A5112     CDS       T00799                                 

Definition
(RefSeq) putative phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH187_A5112
   01230 Biosynthesis of amino acids
    BCAH187_A5112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A5112
  Energy metabolism
   00680 Methane metabolism
    BCAH187_A5112
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCAH187_A5112
Enzymes [BR:bcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCAH187_A5112
Exosome [BR:bcr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCAH187_A5112
  Exosomal proteins of melanoma cells
   BCAH187_A5112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4717661..4718215
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSAAGQERHAELTTDGKKQANTLATFLLENQLQIDHIISSPFVRAIDSIRP
YALLANLSIQEDERLAERILSDVSMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
EDVLKLNHTTILLVTHGNLLTLILKHFDHTIGFHEWRALTNPDMYEITIDEQCSLKRLWK
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcattgtaatacgacattgttcagccgctggacaagaacgtcatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattccttttagaaaaccaa
ctacaaatagatcatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcactcctagctaatttgtctatccaagaagatgaacgcttagctgaacgcatatta
agcgacgtttcaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacggaccgtgctatatcgcttatc
gaagacgttttaaaattaaaccatactacaatattactcgttacacatggaaacttactt
acgctcattttaaagcactttgatcatacgatcggctttcatgaatggagagctttaacg
aatcctgatatgtacgaaattacaattgatgaacaatgtagcctaaaacgattatggaaa
gcaccgtccaagtaa

DBGET integrated database retrieval system