KEGG   Bacillus cereus AH187: BCAH187_A5286Help
Entry
BCAH187_A5286     CDS       T00799                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAH187_A5286 (tpiA)
   01230 Biosynthesis of amino acids
    BCAH187_A5286 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A5286 (tpiA)
   00051 Fructose and mannose metabolism
    BCAH187_A5286 (tpiA)
   00562 Inositol phosphate metabolism
    BCAH187_A5286 (tpiA)
Enzymes [BR:bcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCAH187_A5286 (tpiA)
Exosome [BR:bcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCAH187_A5286 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCAH187_A5286 (tpiA)
  Exosomal proteins of melanoma cells
   BCAH187_A5286 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4875315..4876070)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagttggctatgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaactgaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gctgctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system