KEGG   Brucella canis ATCC 23365: BCAN_A0041Help
Entry
BCAN_A0041        CDS       T00623                                 

Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCAN_A0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABX61145
UniProt: A9M6P4
Position
I:44296..44904
Genome map
AA seq 202 aa AA seqDB search
MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAK
EEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSA
AMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVP
LPAADAAPADSDKKPAEAAPAN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacccggaataacaaatttattatggcatttctggcaacggttttcgttgtc
atgacgacgggcattctgtctgattcgctgtttcattcgccggctcctgaaaagccgggc
tttgccatagaggtagcccaaggttcggggggcggagaaagtgctgcggctcccgccaag
gaagaagtttcaattgcaaccctgttgcaaagtgccgatccggcgcgtggcgaagtggtt
ttcaagcgttgccaggcttgccacaccggggacaagggcggggccaacaaggttggtccg
catctgtggggtgtcgtgggtcgcccggctgcctccgttgaaggtttcagctattccgct
gccatgaaggaattcggcgcggctggcaacaagtgggattttgagcatctcaacaagttc
ctcacctcgccgaaaggcttcatcaagggtacagccatgggctttgccggtgacaagaag
gataatgagcgcgctgacctgattgcttatctgcgcacgctgtccgacaatccggtgccg
ctgccggccgcagacgcagcgcccgcagatagcgataaaaagcccgccgaagctgcaccg
gccaattga

DBGET integrated database retrieval system