KEGG   Brucella canis ATCC 23365: BCAN_A0223Help
Entry
BCAN_A0223        CDS       T00623                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
bcs  Brucella canis ATCC 23365
Brite
Enzymes [BR:bcs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     BCAN_A0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:230485..232965
Genome map
AA seq 826 aa AA seqDB search
MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNLATERADVTFKGTPDL
PAVIEAIRKAGYDVPAGSVDLAIEGMSCASCVSKVEKALSGVPGVTRASVNLATERAHVE
LAGQVALSELIKAVEKAGYEAHALDEARSDARAEAQSEKRDAEAAELKKSVILAAILTLP
VFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGPGLRFFKKGVPTLLRGTPD
MNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGRTS
AAISRLVGLQAKSARVVRDGQAIDVPLEDVRAGDIVQVRPGEKVPVDGEVIEGASYVDES
MITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDMVISQIIRMVQDAQADKLPIQA
MVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIACPCAMGLATPTSI
MVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDTVEGFDKDELLA
LVAAVEARSEHPIADAIVAAAQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMA
KLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAILTVADPMKETTPAAIAALHAQGLKV
AMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALA
AADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALI
PVAGGILYPFTGTLLSPVLAAGAMALSSIFVLSNALRLRRLRLAVQ
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagactgtaaagcctgaggccgtaagctttcccgtgccggtggagggcatgagt
tgcgcttcctgcgtctcttccgtcgaaaaggccgtttccagggtgccgggcgtggacaag
gtttcggtcaacctcgcgaccgagcgcgccgacgtgaccttcaagggcacaccggatctg
cccgctgtgatcgaggctatccgcaaggccggttacgatgttccagcgggctcggtcgat
cttgcgattgaaggcatgagttgcgcttcctgcgtcagcaaggttgaaaaggcgctgagc
ggcgtgccgggcgtgacgcgcgccagtgtcaatctggcaaccgagcgcgcccatgtggaa
cttgccgggcaggtggctttatccgaactcatcaaggcggtcgaaaaggccggttatgag
gcacatgcgctggacgaggcccgcagcgacgccagagcggaagcgcaatctgaaaagcgg
gatgcggaagcggcggaactgaagaaaagcgtcattctggctgccattctcaccctgccg
gtcttcattctggaaatgggttcccatctcatcccggccgtccatatgttcgtcatggac
cggatcgggatgcagaatagctggtatctgcaattcgtgctgacgacgctggttctgttc
gggccgggcctgcgctttttcaaaaagggggttcccacccttctgcgcggcacgccggac
atgaactcgctggtcgtggtcggcacgtttgccgcctggggcttttcggtcgtggccacc
ttcctgccgggcgcgctgccggaaggcaccgtcaacgtctatttcgaggcggcggcgatg
attgtcacgctgatcctgatcggtcgctatctggaggcgcgcgccaagggccgcaccagt
gctgcaatcagccgtcttgtcggtttgcaggccaaatccgcccgtgtggtgcgcgatggg
caggctatcgatgtgccgctggaggatgtgcgcgctggcgacatcgtgcaggtgcgcccc
ggcgaaaaggttcccgtggatggtgaagtgatcgagggtgcgtcctatgtggatgaatcc
atgattaccggtgagccggttcccgttgccaaggaaaagggtgcggcagtggttggcggc
accatcaacaagaccggcgccttcactttccgcgccaccaaggtcggccatgatatggtg
atctcgcagatcattcgcatggtccaggatgcgcaggccgacaagctgcccattcaggcc
atggtggacaaggtgacgggctggttcgtgcccgcggtgatggctgctgcggcgatcacc
ttcgtgctctggcttgccatcggcggcacggccatgatgggttatgcgctggtcaacgcg
attgccgttgtcatcatcgcctgcccgtgcgccatggggcttgccacgccgacgtcgatc
atggttggcaccgggcgcgctgccgagtttggcgttctgttccgtcgcggcgatgcgctg
caaaccctgcgcgacgcctcggtgatcgccgtcgacaagactggaacgctgactgaagga
aagcctgctctcgcccatttcgacacggttgaaggcttcgacaaggatgagcttctggcg
ctggtcgccgccgtcgaggcccgttccgaacatccgattgccgatgcgatcgtcgcagcc
gcgcaggaaaaaggattgaaactcgcggaagtgtccgccttcgaggcggtgccgggcttc
ggcctgaaagcgagcgtaggtgggcgggaagtcgccatcggcgcggatcgctatatggca
aagcttggggccgacgttgccgtctttgcggaagatgcaaagcgctttggcgatgaaggg
caatcgccgctttatgctgcggtggatggcaggctcgcggcgatcctcaccgttgctgat
ccgatgaaggagacgacgccagccgccattgcggctctgcacgcgcaggggctgaaggtg
gcgatgattaccggcgacaatcgccgcacggcgcaagccatcgcacgcaagcttggcatc
gacgaggtggtggcggaagtgctgccggatggcaaggttgcggccttgaagcggctttcg
gcgggtggcaagcgcattgccttcgtgggcgacggcatcaatgatgcgcccgcgctcgcc
gctgccgatgtgggccttgcgattggcaccggcacggatatcgcgattgaaagtgccgat
gtggtgctgatgtcgggcgatctgcgcggcgtggtgaatgccattgcgatctccaaggca
acgatccgcaatatcggcgaaaacctgttctgggcctttgcctataatgtggcgctgatc
ccggtcgcagggggcattctctatcccttcaccggaaccttgctgtcgccggttctggct
gcgggcgccatggcgctttcaagcatcttcgttctgagcaatgccttgcggctgcggcgc
ttacgtcttgccgtgcagtaa

DBGET integrated database retrieval system