KEGG   Brucella canis ATCC 23365: BCAN_A0870Help
Entry
BCAN_A0870        CDS       T00623                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_A0870
   00052 Galactose metabolism
    BCAN_A0870
Enzymes [BR:bcs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BCAN_A0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:829344..830366
Genome map
AA seq 340 aa AA seqDB search
MNSEIFGYAPDGQVVHRLTISNGPLTAKIINWGAAIQDLRMEGHPAPLVIGYRDFADYPA
HSPHLGAIAGRSANRICNARFDLDGTVYEVEPNFLGCHNLHGGSKGLGHHVWKITATGPD
FVSLATVSPDGEMGFPGNLNVNCTYMLNADGTLIVRLEAVTDRPTICNLLHHSYFNLDDG
GEGDVLDHQFKIAGDAYLPVDEALIPDGRVLPVKDTAFDFREFRPLRMQENGRQVAYDNN
FCLAAARGPLRPCASVKAARSGIRLDISTTEPGIQLYAGNTMANDCIGLTGKPYGKHAGF
CLEPQIWPGALEYPYFPQPILRPGDIYAQTSHFTFSREED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatcttcggctatgcgccggacgggcaggtggtccaccgcctcactatc
tccaacgggcctttgaccgcaaagatcatcaattggggcgcagccattcaggatctgcgt
atggaaggccacccggcgccactggtgatcggctatcgcgattttgccgattatccggca
cattccccgcatctgggtgcgattgcgggccgctcggccaaccgtatctgcaatgcgcgc
tttgatcttgatggaacggtttacgaggtggagccgaacttccttggctgccacaatctg
catggcggcagcaaggggctcggacaccatgtctggaagatcacggcgaccggccctgat
ttcgtgtcgcttgcaacggtttctcccgatggcgagatgggcttccccggcaatctgaat
gtgaattgcacctatatgctcaatgcggatggaacgctgattgttcggctggaggctgtg
accgacaggccaaccatatgcaatctgcttcaccacagctatttcaatctggatgacggt
ggtgagggtgatgttctcgaccaccaattcaagattgcaggcgacgcctatcttccggtg
gatgaggcgcttattccggacgggcgggttctgccggtaaaggacacggctttcgatttc
cgcgaattcaggccgcttcgtatgcaggaaaacggccgtcaggtggcgtatgacaataat
ttctgccttgcggctgcacgcggcccgctgcgcccctgcgcttcggtaaaggccgcgcgg
tccggcatccggcttgatatttcaactaccgaaccggggatacagctctatgctggcaac
accatggccaatgattgcataggactgacgggcaagccctatggcaaacatgctggcttt
tgccttgaaccacagatatggccgggcgcgctggaatatccttattttccgcagccgatc
ctgcgcccgggcgatatttacgcacagaccagccattttaccttttcgcgcgaggaggat
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system