KEGG   Brucella canis ATCC 23365: BCAN_A0901Help
Entry
BCAN_A0901        CDS       T00623                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcs  Brucella canis ATCC 23365
Brite
Enzymes [BR:bcs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BCAN_A0901 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD GCD14 Methyltransf_23 Methyltransf_25 CMAS Methyltransf_11 MTS Fibrillarin Methyltransf_4 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ABX61963
UniProt: A9MAR0
Position
I:858249..858917
Genome map
AA seq 222 aa AA seqDB search
MRQATSERPRLSDREGFASFVLRMRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRT
APLDCGEYMEGIDDQARVISALKLEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKL
CDHALQQFVSLKRENIMVKHTDGRHGMPGGPFDRIVIWLACDEVPRHFVELLATHGVLIA
PIGPGDGRQIMTRISKVGSRFEQEDLMPVRYQPFIEGTSSVL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcaacgtctgaacgcccgcggctttcggaccgggagggatttgcatccttt
gttctgcggatgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagca
acgccgcgccagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaacc
gcgccgcttgattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttcc
gccctgaagcttgagcccggccatcgggttctggaaatcggcaccggctccggctttacc
gccgccgttatgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactc
tgcgaccacgctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacat
acagacgggcgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgca
tgcgatgaggtgccgcgccatttcgttgaactgctcgccacccatggcgtcctgatagcc
ccgatcggccctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgt
tttgaacaggaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttcc
gttctttag

DBGET integrated database retrieval system