KEGG   Brucella canis ATCC 23365: BCAN_A0956Help
Entry
BCAN_A0956        CDS       T00623                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcs  Brucella canis ATCC 23365
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:913748..914416
Genome map
AA seq 222 aa AA seqDB search
MVADFQDLRTKMVDNQIRTTDVTDLAVIDAFLTVPREAFVPASRQALAYIDEDQLLESEG
PAPRYIMEPSPFAKLVQLARVSKSDVVLDIGCASGYSAAVLSQLAGSVIGLESDSSLAAA
ATARLQEFGYDNVVIVSGELRAGYPSEAPYDVIFIEGAVDFVPDVLFNQLKEGGRLVAVE
GRGNAGVARLYVKESGVASGRTVFNAAIKPLPGFECEEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatttccaggatcttcgcacaaagatggtcgataaccagatccgcacgacg
gacgtgactgatctggcggttatcgatgcgtttctgaccgttccgcgcgaggcattcgtt
ccggcaagccgtcaggctctggcctatatcgatgaagatcagcttctggaaagcgaaggc
ccggccccgcgttatatcatggagccttcgcccttcgccaagcttgtgcagcttgcccgt
gtcagcaagagcgatgtcgttctcgatatcggctgcgcatccggctattcggcggctgtc
ctttcccaattggctggatcggtcatcggtttggaaagcgattcctcgcttgcagccgcc
gcaacggcgcgtcttcaggaattcggttatgacaacgttgtgatcgtttcgggcgagttg
agggcaggctatccgtccgaagcaccctatgatgttattttcatcgaaggtgcagttgat
ttcgtcccggacgttctgttcaatcagctcaaggaaggcggtcgcctggttgcggtcgaa
ggccgtggaaatgcgggcgttgcgcgtctttacgtcaaggaaagcggcgtggcttccggg
cgtaccgttttcaatgcagcgatcaaaccgctccccggtttcgagtgtgaagagcagttc
gaattttaa

DBGET integrated database retrieval system