KEGG   Brucella canis ATCC 23365: BCAN_A1043Help
Entry
BCAN_A1043        CDS       T00623                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAN_A1043 (folP)
Enzymes [BR:bcs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BCAN_A1043 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:994160..994999
Genome map
AA seq 279 aa AA seqDB search
MTKEWQLAHERSLHLGKTAIIMGVLNVTPDSFSDGGRYNDLDRAIAAAETMLEEGATIVD
VGGESTRPGATAVDAQTEASRVVPVIRELVRRFDCIISVDTYRASTARLAVEAGAHIVND
VWGLQREPEIAQLARETGAGLVIMHTSRDRLTNPDVIEDQFMFLNRSLKIAGDAGIEPSR
IVLDPGFGFGKERDEDIALMARMSELQAFGFPLLVGTSRKRFVGAMTGQADPRNRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADAILQSNVRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaatggcagcttgcccatgaacgcagcctccatctcggaaaaaccgccatc
attatgggagtactgaacgttacgccggattctttctcggatggcgggcgttataacgat
cttgatcgtgccatcgccgctgccgaaacgatgctggaggaaggcgcgaccattgtggac
gttgggggcgaatcgacgcgaccgggcgctactgctgtggatgcgcagacagaagccagc
cgtgtggttccggtaatccgggaactggtgaggcgcttcgattgtatcatttccgtggac
acttatcgtgcttctaccgcgcggcttgcggtggaggccggcgcgcatatcgtcaatgat
gtctgggggcttcagcgcgaaccggaaattgcccagcttgccagagaaacgggggcaggg
cttgtcatcatgcatacgagccgcgaccgcctcacgaatcccgacgtgatcgaagatcag
tttatgttcctgaacaggtcgctgaaaattgccggggatgcaggcatcgagccatcgcgc
atcgtgcttgatccgggtttcggcttcggcaaggagcgggatgaagacattgcgttgatg
gcgcgtatgtctgaattgcaggccttcggattccccctgctggtcggtacatcgcgcaag
cggttcgttggcgcaatgacggggcaggccgatccgcggaaccgcgatatcggcacagcg
gctacttccgtggcccttcgcctggcgggagccgacatcttccgtgttcacaatgtcgct
tttaacagagatgcacttgcagttgcggatgctatcctgcaaagcaacgtcaggatctaa

DBGET integrated database retrieval system