KEGG   Brucella canis ATCC 23365: BCAN_A1076Help
Entry
BCAN_A1076        CDS       T00623                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00010  Glycolysis / Gluconeogenesis
bcs00071  Fatty acid degradation
bcs00350  Tyrosine metabolism
bcs00625  Chloroalkane and chloroalkene degradation
bcs00626  Naphthalene degradation
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_A1076
  Lipid metabolism
   00071 Fatty acid degradation
    BCAN_A1076
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCAN_A1076
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAN_A1076
   00626 Naphthalene degradation
    BCAN_A1076
Enzymes [BR:bcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAN_A1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABX62127
UniProt: A9M572
Position
I:1030510..1031493
Genome map
AA seq 327 aa AA seqDB search
MKAMVLEKPGQPLVLVERPDPLPGPGQIRLKVEACAVCRTDLHVVDGELERPKLPLVPGH
EIVGVIDAVGTGVDPSRTGRRVGVPWLGHTCGACDYCRSGAENLCDAPLFTGYTRDGGFA
THVVADADFAFDLDEAADPVALAPLLCAGLIGWRSLKKAGEGKRIGLYGFGAAAHIIAQV
CRWQDREVYAFTKPGDTEAKDFARSLGAVWAGDSDILPPSPLDAAIIFAPAGELVPAALR
AVRKGGRVVCGGIHMSDIPSMPYSILWEERALVSVANLTRNDAEEFFPLARAAGVRTHTT
IYPLESANEALADLRSGRLSGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatggtgctggagaagccgggacagccactggttctcgtggagcgccctgat
ccgttgccggggccgggccagatcaggctgaaggttgaagcctgcgccgtctgccggaca
gatttgcatgtggtggatggagagcttgaaaggccaaagctgccgctggttcccggacat
gagatcgttggcgttatcgatgccgttggaacgggcgtcgatccgtcacgcacaggacgg
cgtgtgggggttccgtggcttgggcatacttgcggcgcctgtgactattgtcgctccggc
gctgaaaacctgtgcgatgccccgctttttaccggctacacgcgcgatggcgggttcgcc
acccatgtcgtcgcagatgccgattttgctttcgatctcgatgaggccgccgatcctgtg
gctctggcgcccttgctctgcgctgggctgatcggctggcgatcgctgaagaaagcaggc
gagggcaagcgcatcggcctttatggctttggggctgccgcacacatcattgcgcaggtc
tgccgctggcaggacagggaggtttacgctttcacaaagcccggagatacggaagcgaaa
gattttgcgcgcagccttggcgcggtatgggccggagattcagatattctgccgccgtca
ccgctggatgcagctatcattttcgcacccgccggggagctcgttccagccgccttgcgt
gcggtgcgcaagggcggccgggtggtctgcggcggcatccatatgagcgatattccatcc
atgccctattcgatcctgtgggaagaacgcgcgctcgtttccgtcgcaaacctcacccgg
aacgatgcagaagagtttttcccgcttgcccgcgcggcaggcgtgcgcactcacaccaca
atctacccgcttgaaagtgcaaacgaggcgctcgccgatctgcgctccggccgcctcagc
ggggcggctgttcttgtgccatag

DBGET integrated database retrieval system