KEGG   Brucella canis ATCC 23365: BCAN_A1090Help
Entry
BCAN_A1090        CDS       T00623                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCAN_A1090 (folE)
Enzymes [BR:bcs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BCAN_A1090 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1044086..1044727
Genome map
AA seq 213 aa AA seqDB search
MDARILQDNDDTSLPVNQASVTRIHKKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRV
AKAYQELFGGYSESPEEVLGTTFEEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYL
PEGRVVGLSKIARVVDIFARRLQTQESITAQIADSMQRILKPRGVAVMIEAEHMCMAMRS
IRKQGSSTITTTFTGDFKEKADQQVRFMTLIRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctccaagataacgacgacaccagcctgcctgtcaatcaggcatcc
gtaaccagaatacacaaaaagccaggcaaggccgaagcggaagctgccgttcgcaccctg
cttttgtgggccggcgaagaccccgatcgtgaaggcttgctggaaacgcccaagcgcgtc
gcaaaagcctatcaggaacttttcggcggctattcggaaagcccggaagaggttcttgga
accactttcgaggaagtcgcaggttacgacgatatggttctggtgaaggatatttccttc
ttctcccattgcgaacaccacatggtgccgatcatcggcaaggcgcacgtcgcctatctg
ccggaaggccgtgtcgtcggcctgtcgaagattgcgcgtgtcgtcgatatttttgcccgc
cgcctgcaaacgcaggaaagcatcacagcgcagattgccgacagcatgcagcgcattttg
aagccacgcggcgtcgccgtcatgatcgaggcggaacatatgtgcatggccatgcgcagc
atccgcaagcagggttccagcacgatcaccaccacctttaccggcgatttcaaggaaaag
gcggaccagcaggttcgcttcatgaccctgatccgcacttga

DBGET integrated database retrieval system