KEGG   Brucella canis ATCC 23365: BCAN_A1157Help
Entry
BCAN_A1157        CDS       T00623                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAN_A1157 (tpiA)
   01230 Biosynthesis of amino acids
    BCAN_A1157 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_A1157 (tpiA)
   00051 Fructose and mannose metabolism
    BCAN_A1157 (tpiA)
   00562 Inositol phosphate metabolism
    BCAN_A1157 (tpiA)
Enzymes [BR:bcs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BCAN_A1157 (tpiA)
Exosome [BR:bcs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BCAN_A1157 (tpiA)
  Exosomal proteins of bladder cancer cells
   BCAN_A1157 (tpiA)
  Exosomal proteins of melanoma cells
   BCAN_A1157 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1114367..1115131)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggcaatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system