KEGG   Brucella canis ATCC 23365: BCAN_A1160Help
Entry
BCAN_A1160        CDS       T00623                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01130  Biosynthesis of antibiotics
bcs01230  Biosynthesis of amino acids
Module
bcs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCAN_A1160 (trpC)
Enzymes [BR:bcs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCAN_A1160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABX62209
UniProt: A9M5F4
Position
I:1118287..1119093
Genome map
AA seq 268 aa AA seqDB search
MSTDILRKIEAYKREEIAAAKARLALDELKARTRDQSAPRGFLKALEAKRAAGQFALIAE
IKKASPSKGLIRPDFDPPALAKAYEEGGAACLSVLTDTPSFQGAPEFLTAARQACSLPAL
RKDFLFDPYQVYEARSWGADCILIIMASVDDDLAKELEDTAFALGMDALIEVHDEAEMER
ALKLSSRLLGVNNRNLRSFEVNLAVSERLAKMAPSDRLLVGESGIFTHEDCLRLEKSGIG
TFLIGESLMRQHDVAAATRALLTGAEKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatattcttcgcaagatcgaagcctataagcgggaagaaatagccgccgcc
aaggcgcgtcttgcccttgatgaactgaaggcccggacgagggatcagtcagcgccgcgc
ggttttctgaaggcacttgaggccaagcgcgccgccggtcaatttgcactgatcgcggag
ataaagaaagcaagcccgtccaaaggcttgatccgccccgatttcgacccgccagcgctt
gcaaaggcttatgaagaaggcggtgcggcctgtctttccgtgctgaccgacacgccttcc
tttcagggcgcgccggaattcctcacggccgcacgccaggcttgcagcctgcccgcattg
cgcaaggatttcctgttcgacccctatcaggtctatgaagcgcgtagctggggagcggat
tgcattctcatcatcatggccagcgtcgatgacgatcttgcaaaagagctggaagacacg
gctttcgcactgggcatggatgcgctgatcgaagtgcatgacgaagctgaaatggaacgc
gccctgaagctttcctcgcgcctgctcggcgtcaacaatcgcaatctgcgcagcttcgag
gtcaatctcgccgtttccgagcggcttgcgaaaatggctccgtccgaccgtctgctggtt
ggcgaaagcggcatcttcacgcatgaggactgcctgcggcttgaaaagtccggcatcggc
acttttctgataggcgaaagccttatgcgacaacatgacgttgcggcagccacccgcgcg
cttttgacgggtgcggaaaagctatga

DBGET integrated database retrieval system