KEGG   Brucella canis ATCC 23365: BCAN_A1258Help
Entry
BCAN_A1258        CDS       T00623                                 

Gene name
tuf
Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
bcs  Brucella canis ATCC 23365
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1199688..1200863)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEERARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKCDQVDDAELLELVELEVRELLSKYEFPGDEIPIIKGSALAALEDSSKE
LGEDAIRNLMDAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATTKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPAGTEMVMPGDNVAMDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgaacgtacgaagccccacgttaacatcggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtttttcggcgaattcaag
gcgtatgaccagatcgacgccgcgcctgaagaacgcgcccgcggcatcacgatctcgacg
gcccacgtcgagtacgagaccgcaaaccgtcactatgcacacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggcgctgcccagatggatggcgcgatcctggtg
gtttcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggcgatcgtcgtgttcctcaacaagtgcgaccaggttgacgatgcagaa
ctgctcgaactggttgaactggaagtgcgcgaacttctgtcgaagtacgaattccccggc
gacgaaatcccgatcatcaagggctcggctcttgctgctctggaagattcttccaaggaa
ctgggcgaagatgccatccgcaacctgatggacgcggttgacagctacattccgaccccg
gaacgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgttaaggtcggtgaagaagtt
gaaatcgtcggcatcaaggcgacgacgaagaccacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacattggcgcgctgatccgcggcgttggc
cgtgaagacgttgaacgcggccaggttctctgcaagccgggttctgtgaagccgcacacc
aagtttaaggcagaagcctatattctgaccaaggacgaaggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgtacgacggacgtgacgggtgttgtgacg
cttccggctggcacggaaatggtcatgcctggcgataacgtcgccatggacgttaccctg
atcgtgccgatcgccatggaagagaagcttcgcttcgctatccgtgaaggcggccgcacc
gtcggtgccggcatcgtctcgtcgatcatcgagtaa

DBGET integrated database retrieval system