KEGG   Brucella canis ATCC 23365: BCAN_A1572Help
Entry
BCAN_A1572        CDS       T00623                                 

Definition
50S ribosomal protein L25/general stress protein Ctc
Orthology
K02897  
large subunit ribosomal protein L25
Organism
bcs  Brucella canis ATCC 23365
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:bcs03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1484493..1485116
Genome map
AA seq 207 aa AA seqDB search
MSETYVLKADLRTRVGKGSSRELRRNGQIPAVIYGDKQEPLAIAVSYKEIFYKIHGGGFK
TTVATIEVDGKKIQVLPKDYQLDPVRDFPQHVDFLRVSAKSVVHVNVPVHFKNEEAAPGI
KRGGVLNVVRHDVELIVPANAIPEALEIDLSGLEIGDSVHISAVKLPKGATPAIQDRDFT
IATIAAPAGLKSEENAEGTAEEAKDGE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacttacgtgctcaaggccgatctgcgtacccgggttggtaaggggtcctcc
cgcgaactgcgtcgcaacggccagattcctgcagtcatctatggcgacaagcaggagccc
ctcgcaatcgccgtctcctacaaggagattttctacaagatccatggcggtggcttcaag
accacggttgccacgatcgaagtggacggcaagaagattcaggtcctcccgaaggactac
cagcttgatccggtccgtgacttcccgcaacatgtcgacttcctgcgcgtttccgcgaag
tcggtcgtccacgtgaatgttccggttcacttcaagaacgaagaagcagcgcccggcatc
aagcgcggcggcgtgctgaacgtggttcgtcacgatgtcgaactgatcgttccggccaat
gcaattcccgaagcactcgaaatcgacctgagcggccttgaaatcggtgactcggttcat
atttcggctgtcaagctgccgaagggcgcaacgcctgccatccaggaccgcgacttcacc
atcgcgaccattgctgcgcctgccggcctgaagtcggaagaaaacgcagaaggcactgcg
gaagaagccaaggacggcgaataa

DBGET integrated database retrieval system