KEGG   Brucella canis ATCC 23365: BCAN_A2002Help
Entry
BCAN_A2002        CDS       T00623                                 

Gene name
pah
Definition
proclavaminate amidinohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcs00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1884837..1885850
Genome map
AA seq 337 aa AA seqDB search
MTDKLTSAPKHGHTSMLYSKVHTDLDTLDAHIAFLGIPYGSAYTIDEVTNDQTRAPTAVR
QATDRAVRNLDRYDFDVDGPLYDGRAIKAVDCGDVVGDPKDPGAHYRNAEAAVRKILAAG
ALPLIIGGDHGIPIPVLRAYDDQGPITLIQIDAHLDWRDHINGVHDGLSSPIRRASEMAH
VKDIFQIGIRAQGTARPEEYEAARAYGSNIITAYELHDVGMDAILDRIPDGGRYYITIDA
DGIDPSVMPAVAGPAFGGVTYAQTRKLLHGLVKKGRVVGMDIVEITPSKDVNQLTAIAAG
RFFVNLIGAAVRADYFGTKAELETAAGKTMKPAHAAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcttacctccgcgccaaagcatggacatacgagcatgctttattccaag
gttcacacggatctcgacacgctcgacgcccacatcgcctttcttggtattccttacggc
tctgcctatacgatcgatgaagtcaccaacgaccagacgcgggcgccgacagcagtgcgc
caggcgaccgaccgtgccgtccgcaacctcgaccggtatgacttcgacgtcgatggccct
ctctacgatggccgtgccatcaaggcggtcgattgcggcgatgtggtgggcgaccccaag
gaccctggcgcacattaccgcaatgcggaagcagccgttcgcaagattctcgccgccggc
gccctgcccctcatcatcgggggcgatcacggcatcccgatcccggtcctgcgcgcctat
gacgatcaggggccgatcaccctgatccagatcgacgcccatctggactggcgtgatcac
atcaatggtgtgcatgacggcctttcaagcccgatccgccgcgcttcggaaatggcgcat
gtcaaggatatcttccagatcggcatccgcgcccagggcacggcacgccccgaagaatac
gaggccgcgagagcttacggctccaatatcatcacagcttacgaattgcatgatgtcggc
atggacgccattctcgatcgtattcccgatggcgggcgctattacatcaccatcgatgcc
gacgggatcgatccttccgtcatgcctgcggtggctggtcccgcctttggcggtgtgacc
tatgcccagacgcgcaaactcctgcatggccttgtcaagaaggggcgcgtcgtcggcatg
gatatcgtggagattacgccttccaaggatgtaaaccagcttaccgcgatcgccgccgga
cgtttcttcgtcaacctgattggtgctgccgtgcgcgccgactatttcggcacgaaagca
gagcttgaaacggccgctggcaaaaccatgaaaccggcccacgccgcagcctga

DBGET integrated database retrieval system