KEGG   Brucella canis ATCC 23365: BCAN_B0074Help
Entry
BCAN_B0074        CDS       T00623                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCAN_B0074 (galU)
   00052 Galactose metabolism
    BCAN_B0074 (galU)
   00500 Starch and sucrose metabolism
    BCAN_B0074 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAN_B0074 (galU)
Enzymes [BR:bcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCAN_B0074 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:69384..70277
Genome map
AA seq 297 aa AA seqDB search
MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDEAREAGIEHLIFVT
GRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSFTRQQVPLGLGHAVWC
ARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAVQECDPEEAHKYGIVGKG
GAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLLSKQEKGAGNEIQLTDAMLK
LADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDIRPSVESSIGHLLKTIQPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttctattcggaaaatccgcaaggcagtctttcccgtcgcaggtcttggaacgcgc
ttcctgcccgcaaccaaatccatcccgaaggaaatgctgacggttgttgacaaacccgtc
atccaatatgtcgtggacgaagcgcgcgaggcgggtattgaacacctgattttcgttacg
gggcgcaacaaggctgtcatcgaggattatttcgatgcgcaggtggagctttattccaca
ctggccgaacgggggaaaaccgaagagttgaaccgcctgcaggatttgcagccgcagccg
ggcaccaccagctttacccgccagcaggtgccgcttggcctcggccacgctgtctggtgt
gcgcgggaactggtgggcaacgaaccttttgcactgcttctgcctgatatggtgatgcag
tcgaaaaagggctgccttgccgaaatggtcgaactttacgaacagaccggcggcaatatc
atcgccgtgcaggaatgcgacccggaagaggcgcataaatacggtatcgtgggcaagggc
ggcgctgtcggcaatggcttcgagattacgcgcatggtcgaaaagccggctaagggcacg
gcgccgtccaatctctatatcaatgggcgctatatcctccagccggagattttcgggctg
ttgagcaagcaggaaaagggtgcgggcaacgaaatccagctgaccgacgccatgctgaag
cttgccgaccagcagaagttctatggcttcgattatcgcgggctgaccttcgattgcggc
tcgaaggcaggcttcattgaggccaatgtggctttcgcactatggcgtgaggatatccgc
ccgtccgtggaaagctccatcggccatctgttgaagacgatccagccagcctga

DBGET integrated database retrieval system