KEGG   Brucella canis ATCC 23365: BCAN_B0452Help
Entry
BCAN_B0452        CDS       T00623                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCAN_B0452
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAN_B0452
   00620 Pyruvate metabolism
    BCAN_B0452
   00640 Propanoate metabolism
    BCAN_B0452
  Energy metabolism
   00680 Methane metabolism
    BCAN_B0452
Enzymes [BR:bcs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAN_B0452
Lipid biosynthesis proteins [BR:bcs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAN_B0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(437992..439662)
Genome map
AA seq 556 aa AA seqDB search
MTESPASARLDRYDDAVAQFDIAKAIALLAGNPDTGINACIECCDRYTGENRVALRAISI
DNTLTELTFEDLRDMSARVGNMLADAGISAGDVVAGLLPRTPELVATILGAWRIGAIYQP
LFTAFGPKAIEQRFGTSGAKLVVTNLANRSKLAEVENCPRVATILAPGESLPEGDIDFRA
AVAAASTECEPVMRKGSDLFMMMSTSGTAGLPKGVPVPLRALMAFGAYMRDAVGLRSDDI
FWNIADPGWAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRL
LIAAGPESAARVKGRLRVVSSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHG
LEHPVRQGSAGYAMPGYRVAVLDEAGKEVGPNEPGVLAIDIDNSPLLWFTGYYKKDTPSI
SGGYYRTGDTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLKHPAVNEAAVVGVP
DPQRTEIVKAFVILAPGFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQ
RFLLRKAEVEKQQQQN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaagccctgcttcagcacggctcgaccgctacgatgatgccgttgcgcagttc
gatattgcaaaagccattgcgcttcttgcaggaaatcctgatacgggtatcaatgcctgc
attgaatgctgcgaccgatatacgggcgaaaatcgcgtggcgctgcgcgccatttccatc
gacaatacgttgactgaactcacctttgaagacctgcgcgatatgtccgcgcgggtcggc
aatatgctggccgatgccgggatcagcgcaggcgatgtggttgccggtcttctcccccgc
acgcctgaactcgtcgccaccattctcggcgcctggcgcatcggcgcaatctatcagccg
cttttcaccgccttcggcccaaaagccatcgaacagcgtttcggcaccagtggcgccaaa
ctcgtcgtcaccaacctggccaatcgttccaaattggccgaagtggaaaactgcccccgc
gtcgcaaccattcttgcccccggtgaaagcctgccggaaggcgatatcgactttcgcgca
gccgtggcggcagcatcgaccgaatgcgagcccgtcatgcgcaagggcagcgaccttttc
atgatgatgtccacctccggcacggcgggcctgcccaaaggcgtcccggtgccgctgcgc
gccctgatggctttcggcgcctatatgcgcgatgccgtgggcctgcgcagcgacgatatt
ttctggaatatcgccgatccgggctgggcatatgggctttactatgccgtgacgggtccc
ctgcttctgggtgtgccgacgatcctgaacgaaggcggtttcaccgccgaaaacacctat
gacatcatcgaacgcctcggcgtgacgagccttgcgggctctccgactgccttccgcctg
cttatagccgccgggccggaatctgctgcccgcgtcaagggccgcttgcgcgtggtatcc
agcgcgggcgagccgctgaacccggaagtcattcgctggttcgatgcctgtcttggcgcg
ccgatccacgatcattacggccagacggaactgggcatggtggtgaacaaccatcatgga
ttggaacatccggtgcggcagggttcggcgggctatgccatgccgggctacagggttgcg
gttctggatgaagcgggcaaagaagtcggccccaatgaaccgggcgttctggccattgat
atcgacaattcgccgcttctctggttcaccggctattataaaaaggatacgccctccatc
tccggcggatattatcgcaccggcgatacggtggaattcgagccggatgggtctatcagc
ttcatcggccgcgccgatgacgtcatcacctcctccggctatcgcatcgggcctttcgat
gtggaaagcgcgcttctgaaacatcctgcggtcaacgaggctgcggtggtcggcgttccc
gatccgcaacgcaccgaaatcgtgaaggcctttgtcatcctggcccccggcttcgagggt
acgccggaactggcggaagaactggcgcttcacgtcaagaaacagctttccgcccatgcc
tatccgcggcagatcgactttgtggcggagcttcccaagacgccgagcggaaaaatacag
cgcttcctcctgcgcaaggcggaagtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system