KEGG   Brucella canis ATCC 23365: BCAN_B0807Help
Entry
BCAN_B0807        CDS       T00623                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bcs  Brucella canis ATCC 23365
Pathway
bcs00071  Fatty acid degradation
bcs00280  Valine, leucine and isoleucine degradation
bcs00281  Geraniol degradation
bcs00310  Lysine degradation
bcs00362  Benzoate degradation
bcs00380  Tryptophan metabolism
bcs00410  beta-Alanine metabolism
bcs00640  Propanoate metabolism
bcs00650  Butanoate metabolism
bcs00903  Limonene and pinene degradation
bcs00930  Caprolactam degradation
bcs01040  Biosynthesis of unsaturated fatty acids
bcs01100  Metabolic pathways
bcs01110  Biosynthesis of secondary metabolites
bcs01120  Microbial metabolism in diverse environments
bcs01130  Biosynthesis of antibiotics
bcs01200  Carbon metabolism
bcs01212  Fatty acid metabolism
Module
bcs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAN_B0807 (fadJ)
   00650 Butanoate metabolism
    BCAN_B0807 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    BCAN_B0807 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    BCAN_B0807 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAN_B0807 (fadJ)
   00310 Lysine degradation
    BCAN_B0807 (fadJ)
   00380 Tryptophan metabolism
    BCAN_B0807 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAN_B0807 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCAN_B0807 (fadJ)
   00281 Geraniol degradation
    BCAN_B0807 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAN_B0807 (fadJ)
   00930 Caprolactam degradation
    BCAN_B0807 (fadJ)
Enzymes [BR:bcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BCAN_B0807 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCAN_B0807 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BCAN_B0807 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N F420_oxidored FAD_binding_3 NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA 2-Hacid_dh_C NAD_binding_7 Pyr_redox_2 NAD_binding_8 DFP TrkA_N GIDA Pyr_redox Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABX63967
UniProt: A9MC80
Position
II:complement(774137..776353)
Genome map
AA seq 738 aa AA seqDB search
MAYVNFKVETDADGIALVTWDMPEKSMNVFTVDAMQELNAIIDAVIADDKIKGVVITSGK
ETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMSGLFRKLETCGKPWVSAIN
GTCMGGAFEMSLACHARVASDAPGVKMALPEVKVGLFPGAGGTQRVPRLANQQDALQMMT
TGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLKPVQPWDEKGFKLPGGAIYSAAG
ANLWPAATAILRRETSGNYPAALAILKSVYEGLLVPFDTGLKIEQRYFTEILQTTEAGMM
IRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGAGFMGAGIAYVTAKAGIPVVLIDRDQE
SADKGKAHTADLITKEMQKGHATEADKEKLLSLITATPDYAQLEGADLVIEAVFEDREVK
RVATEKAEEVLKSSAVFASNTSTLPITGLAKVSKRPKNFIGIHFFSPVDKMMLVEVILGK
KTSDKALAVALDYVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYNMLVEGVPAAMIENAA
RMAGMPVGPLALNDETAIDLSQKILKATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNG
KGFYDYPAKPAKKHLWPGLKDLYPQQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGTLSYIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENG
ETFYQRFNPYKGETKKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtaaatttcaaggttgaaaccgacgccgacggcattgctctcgttacatgg
gacatgcccgaaaagtcgatgaatgtcttcaccgtcgatgcgatgcaggaactgaatgca
atcatcgatgcggtgatagctgacgacaagatcaagggtgttgtcatcacctccggcaag
gaaaccttctccggcggtgccgacctgaccatgctggaaggcatgttcaaggaattccag
aagcagaaggtcaaggaccccgaaggcgcggttcagaccctgttcgacaatgtcggcaag
atgagcggcctgttccgtaagcttgaaacctgcggcaaaccgtgggtttcggccatcaac
ggcacctgcatgggcggcgcatttgaaatgtcgctcgcctgccatgcgcgtgtggcgtcc
gatgcgccgggcgtgaagatggccctgccggaagtgaaggtcggccttttccccggtgct
ggcggcacgcagcgcgttccgcgccttgccaaccagcaggacgcgcttcagatgatgacg
acgggttcaagcctcaccgcgcagcgcgccaaggctatgggccttgtcaccgagattgct
ccggccaagaagctggtcgaaacagccaagaagctcatcaagggtggcctcaagccggtt
cagccctgggatgaaaagggcttcaagctgccgggcggcgcgatttattcggctgccggt
gcaaacctctggcctgccgcgaccgccatcctgcgtcgcgaaacatcgggtaattatccg
gcggcactcgccattttgaagtcggtttatgagggccttctggtgcctttcgacaccggc
ctcaagattgaacagcgctatttcaccgaaatcctccagacgaccgaagcgggcatgatg
atccgctcgctcttcgtgtcgttgcaggagttgaacaagggtgcgcgccgtccggttgac
gaaaagccgaccaggctcaagaagatcggcgtcatcggcgcgggcttcatgggtgcaggc
attgcctatgtgacggcgaaggccggtattccggtcgtgctgatcgaccgcgatcaggaa
tctgccgacaagggcaaggcccacacggcagacctaatcaccaaggaaatgcagaagggc
catgccaccgaggccgacaaggaaaaacttctgtcgctcatcacagcaacgccggattat
gcccagcttgaaggtgctgatctggtgattgaagccgtgttcgaggaccgcgaagtcaag
cgcgttgcgaccgagaaggccgaggaagtgctgaaatcttccgcagtcttcgcctccaac
acctcgaccctgccgatcaccggtcttgccaaagtgtcgaagcgtccgaagaattttatc
ggcatccacttcttctcgcctgtcgacaagatgatgctggtggaagtgatcctcggcaag
aagacctctgacaaggcattggccgtagcactcgattatgtccgtgcgatcaagaagacg
ccgatcgtcgtcaacgatacgcgcggcttctacgtcaaccgttgcgtgctgcgctatatg
tcggaagcctacaacatgcttgttgaaggcgtcccggcggcgatgatcgaaaatgccgcc
cgcatggccggtatgccggtcggcccgcttgcgctcaacgacgaaacggccatcgacctg
tcgcagaagatcctgaaagccacgcttgccgatcttggtccgaaggccgttgacccgcgc
catgtggaattggtggacaagcttgtcaacgagttcgaccgcaagggccgcaagaatggc
aagggcttctacgattatccggcaaagcctgccaagaagcatttgtggccgggtctgaaa
gacctctatccgcagcagaacccggacaagatcgatgtgaaggagcttaaagagcgcttc
ctcgtcaccatcgctctggaagctgcccgcgtgatggaagaaggcattgtgaccgatccg
cgtgaagccgatgtcggctccatcctcgccttcggtttcgcgccttatacgggcggcacg
ctctcctatatcgatggtatgggcgcgaagaaattcgtccagctcgccaaggatttgcag
aagaaatatggcgcacagttcaaggcgccgaagcttctgctcgatatggccgagaacggc
gaaaccttctaccagcgtttcaatccctataagggcgaaacgaaaaaagcagcctga

DBGET integrated database retrieval system