KEGG   Brucella canis ATCC 23365: BCAN_B0943Help
Entry
BCAN_B0943        CDS       T00623                                 

Gene name
dadA
Definition
D-amino acid dehydrogenase small subunit
Orthology
K00285  
D-amino-acid dehydrogenase [EC:1.4.99.1]
Organism
bcs  Brucella canis ATCC 23365
Pathway
Phenylalanine metabolism
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bcs00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:908907..910157
Genome map
AA seq 416 aa AA seqDB search
MQITILGSGVIGVTTAYYLAKLGHEVTVIDREEGPAPETSFANAGQVSPGYASPWAAPSI
PLKAAKWLFQKHAPLILRLTTDPVQYRWLLQMLANCTDSRYKINKTRMVRVAEYSRDCLI
ELRKDTGIEYDQRSQGTLQLFREQYQLDGIGKDIEVLRQDGVPFEVLDRDGCVNVEPALA
HAKDKFVGGLRLPNDETGDCFKFTNALAKIAEGLGVKFRFGVNIKSLLMSGGKISGVETS
EGIVTAERYVVALGSYTPALIKALGLNAPIYPVKGYSITAPIVDESRAPVSTVLDESYKI
AITRLGDRIRVGGMAEVSGFTDDLPAARRATLDLSVTDLFPGGDLKAATFWSGLRPMTPD
STPIIGGTRYDNLFINAGHGTLGWTMACGSGRLLADLISGNKADIRADDLGIARYN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcactattctcggtagcggcgtcatcggcgttacgacggcctactatctcgcc
aagctcggccatgaagtaacggtcatcgaccgtgaagaaggcccggcgcccgaaacctcc
ttcgccaatgcaggtcaggtttcgccaggctatgcgtccccctgggctgcccccagcatt
cccctgaaggcggccaagtggctctttcagaaacatgccccgctcattctccgcctcacc
accgatccggtacaatatcgctggctgctgcagatgctcgccaactgcaccgacagccgg
tacaagatcaacaagacgcgcatggtgcgcgtggccgaatatagccgcgattgcctgatc
gagttgcgcaaggataccggcattgaatatgaccagcgctcgcagggtaccttgcagctt
ttccgcgagcaataccagctcgacggcattggcaaggatatcgaggttctgcgtcaggac
ggcgtaccgttcgaggtgctcgaccgcgacggatgcgtgaacgtggagccggcgcttgcc
catgcgaaggacaagttcgtcggtggcctgcgcctgccgaacgacgagaccggtgactgt
ttcaaattcaccaatgccttggcgaagattgccgaagggctgggcgtgaagttccgcttc
ggcgtcaacatcaagtcgctgctcatgtcgggcggcaagatttccggcgtggagacctct
gagggcatcgtcaccgccgaacgctatgtcgtggcgcttggcagctatacgccggcactc
atcaaggcgcttggcctcaacgccccgatctatccggtgaagggttattccatcaccgca
ccgatcgtcgatgaaagccgcgcaccggtttcaaccgttctggatgaaagctacaagatc
gccatcacccgcctcggcgaccgcatccgcgtcggcggcatggcggaagtgtcaggcttt
accgatgacctgcccgccgcgcgccgcgccacactcgacctgtcggtgacagatctcttc
cccggcggcgatctcaaggctgcaaccttctggtcgggcctgcgccccatgacaccggat
tccacgcctatcatcggcggcacgcgctatgacaacctgttcatcaatgcaggccacggt
acgctcggctggaccatggcctgcggctccggccgcctgcttgccgatctgatttccggc
aacaaggcggatatccgcgccgacgatctgggcattgcgcgctataattaa

DBGET integrated database retrieval system