KEGG   Burkholderia cepacia GG4: GEM_0169Help
Entry
GEM_0169          CDS       T02205                                 

Definition
(GenBank) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct02020  Two-component system
bct02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bct00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GEM_0169
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GEM_0169
Enzymes [BR:bct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GEM_0169
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GEM_0169
Two-component system [BR:bct02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GEM_0169
Bacterial motility proteins [BR:bct02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GEM_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AFQ46629
UniProt: J7J2Q4
Position
1:186532..187623
Genome map
AA seq 363 aa AA seqDB search
MTAVQKIKVLCVDDSALIRSLMTEIINSQPDMTVCATAPDPLVARELIKQHNPDVLTLDV
EMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGML
DYAEKLADKIRAASRARVRQAPQPQAVARAAGSHPAAPLVNNPLVSTEKLIIIGASTGGT
EAIREVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKEAEHGERVLPGHAYIA
PGHAHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAAQHAGKNAIGVILTGMGRDGA
AGLLDMKRAGAHTFAQDEASCIVFGMPREAIALGGADEIAPLAEMSRRVMARLATMGDRV
QRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtgcagaagatcaaagtgttgtgcgtcgacgactcggcgctgattcgcagc
ctgatgacggagatcatcaatagccagcccgacatgacggtgtgcgcgaccgcgcccgat
ccgctcgtcgcgcgcgaactcatcaagcagcacaacccggacgtcctgacgctggacgtc
gaaatgccgcgcatggacgggctcgacttcctcgagaagctgatgcgcttgcggccgatg
ccggtcgtgatggtgtcgtcgctgaccgagcgcggctcggagatcacgctgcgcgcgctc
gaactcggcgcggtggattttgtgacgaaaccacgcgtcgggattcgcgacggcatgctc
gactatgcggagaagctcgcggacaagatccgcgcggcgtcgcgcgcgcgcgtgcggcag
gcgccgcagccgcaggcagtcgcgcgcgcagcgggcagccacccggccgcgccgctggtc
aacaacccgctcgtcagtaccgagaagctgatcatcatcggcgcgtcgacgggcggcacc
gaggcgatccgcgaagtgctgacgccgctgccgccggatgcgccggcggtgctgatcgcg
cagcacatgccgcccggcttcacgaaatcgttcgcgcagcggctcaacggcctgtgccgg
atcgcggtgaaggaagccgagcacggcgagcgggtgctgcccggccatgcgtatatcgcg
ccgggccatgcgcacctgttgctcgcacgcagcggcgcaaactacatcgcgcagctgtcc
gacgagccgccggtgaatcgccatcgcccgtcggtcgacgtgctgttccgctcggcggcg
cagcacgcgggcaagaacgcgatcggcgtgatcctcacggggatgggtcgcgacggcgcg
gccggcctgctggacatgaagcgcgcgggcgcccacacctttgcgcaggacgaggcgagt
tgcatcgtgttcgggatgccacgcgaggcgatcgcgctcggcggcgcggacgagatcgcg
ccgctcgccgagatgagccggcgcgtgatggcgcggctcgcaacgatgggcgaccgcgtg
cagcgggtctga

DBGET integrated database retrieval system